KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100409044Help
Entry
100409044         CDS       T03264                                 

Gene name
TRAV8-6S1
Definition
(RefSeq) T-cell receptor alpha chain V region PY14
  KO
K10784  T cell receptor alpha chain V region
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04014  Ras signaling pathway
cjc04015  Rap1 signaling pathway
cjc04020  Calcium signaling pathway
cjc04064  NF-kappa B signaling pathway
cjc04514  Cell adhesion molecules (CAMs)
cjc04612  Antigen processing and presentation
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc04660  T cell receptor signaling pathway
cjc04672  Intestinal immune network for IgA production
cjc04940  Type I diabetes mellitus
cjc05142  Chagas disease (American trypanosomiasis)
cjc05144  Malaria
cjc05150  Staphylococcus aureus infection
cjc05162  Measles
cjc05166  Human T-cell leukemia virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05202  Transcriptional misregulation in cancer
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cjc05310  Asthma
cjc05320  Autoimmune thyroid disease
cjc05321  Inflammatory bowel disease (IBD)
cjc05322  Systemic lupus erythematosus
cjc05323  Rheumatoid arthritis
cjc05330  Allograft rejection
cjc05332  Graft-versus-host disease
cjc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100409044 (TRAV8-6S1)
   04015 Rap1 signaling pathway
    100409044 (TRAV8-6S1)
   04064 NF-kappa B signaling pathway
    100409044 (TRAV8-6S1)
   04020 Calcium signaling pathway
    100409044 (TRAV8-6S1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    100409044 (TRAV8-6S1)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    100409044 (TRAV8-6S1)
   04660 T cell receptor signaling pathway
    100409044 (TRAV8-6S1)
   04658 Th1 and Th2 cell differentiation
    100409044 (TRAV8-6S1)
   04659 Th17 cell differentiation
    100409044 (TRAV8-6S1)
   04672 Intestinal immune network for IgA production
    100409044 (TRAV8-6S1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100409044 (TRAV8-6S1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100409044 (TRAV8-6S1)
  09163 Immune disease
   05310 Asthma
    100409044 (TRAV8-6S1)
   05322 Systemic lupus erythematosus
    100409044 (TRAV8-6S1)
   05323 Rheumatoid arthritis
    100409044 (TRAV8-6S1)
   05320 Autoimmune thyroid disease
    100409044 (TRAV8-6S1)
   05321 Inflammatory bowel disease (IBD)
    100409044 (TRAV8-6S1)
   05330 Allograft rejection
    100409044 (TRAV8-6S1)
   05332 Graft-versus-host disease
    100409044 (TRAV8-6S1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100409044 (TRAV8-6S1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100409044 (TRAV8-6S1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100409044 (TRAV8-6S1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100409044 (TRAV8-6S1)
   05170 Human immunodeficiency virus 1 infection
    100409044 (TRAV8-6S1)
   05162 Measles
    100409044 (TRAV8-6S1)
   05169 Epstein-Barr virus infection
    100409044 (TRAV8-6S1)
  09174 Infectious disease: parasitic
   05144 Malaria
    100409044 (TRAV8-6S1)
   05142 Chagas disease (American trypanosomiasis)
    100409044 (TRAV8-6S1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set Ig_2 Ig_3 I-set ig
Motif
Other DBs
NCBI-GeneID: 100409044
NCBI-ProteinID: XP_009003977
Ensembl: ENSCJAG00000008813
Position
10
AA seq 130 aa AA seqDB search
MLLLLVPVLAVIFVLGGTRAQSVTQLDGQVTVSEEAPVLLKCNYSSSVTVYLFWYVQYPN
QGLQLLLKYVSGPTLVKGIKGFEAEIKKSESSFHLRKSSAHVSDAAEYFCAVSDTVPETA
GELNTNPLRC
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgcttctgctgctcgtcccagtgctcgcggtgatttttgtcctgggaggaaccagagcc
cagtctgtgacccagcttgacggccaggtcactgtctctgaagaagcccctgtgctgctg
aagtgcaactactcgtcgtctgttacagtgtatctcttctggtatgtgcaataccccaac
caaggactccagcttctcctgaagtatgtatcaggacccaccctggttaaaggcatcaaa
ggttttgaggctgaaattaagaagagtgaaagctccttccacctgaggaaatcctcagcc
catgtgagcgacgcagctgagtacttctgtgctgtgagtgacacagtgcctgagactgca
ggggagctgaacacaaaccccctgagatgctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100896470Help
Entry
100896470         CDS       T03264                                 

Gene name
TRBV7-9
Definition
(RefSeq) T-cell receptor beta chain V region CTL-L17
  KO
K10785  T-cell receptor beta chain V region
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04014  Ras signaling pathway
cjc04015  Rap1 signaling pathway
cjc04020  Calcium signaling pathway
cjc04064  NF-kappa B signaling pathway
cjc04514  Cell adhesion molecules (CAMs)
cjc04612  Antigen processing and presentation
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc04660  T cell receptor signaling pathway
cjc04672  Intestinal immune network for IgA production
cjc04940  Type I diabetes mellitus
cjc05142  Chagas disease (American trypanosomiasis)
cjc05144  Malaria
cjc05150  Staphylococcus aureus infection
cjc05162  Measles
cjc05166  Human T-cell leukemia virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05202  Transcriptional misregulation in cancer
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cjc05310  Asthma
cjc05320  Autoimmune thyroid disease
cjc05321  Inflammatory bowel disease (IBD)
cjc05322  Systemic lupus erythematosus
cjc05323  Rheumatoid arthritis
cjc05330  Allograft rejection
cjc05332  Graft-versus-host disease
cjc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100896470 (TRBV7-9)
   04015 Rap1 signaling pathway
    100896470 (TRBV7-9)
   04064 NF-kappa B signaling pathway
    100896470 (TRBV7-9)
   04020 Calcium signaling pathway
    100896470 (TRBV7-9)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    100896470 (TRBV7-9)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    100896470 (TRBV7-9)
   04660 T cell receptor signaling pathway
    100896470 (TRBV7-9)
   04658 Th1 and Th2 cell differentiation
    100896470 (TRBV7-9)
   04659 Th17 cell differentiation
    100896470 (TRBV7-9)
   04672 Intestinal immune network for IgA production
    100896470 (TRBV7-9)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100896470 (TRBV7-9)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100896470 (TRBV7-9)
  09163 Immune disease
   05310 Asthma
    100896470 (TRBV7-9)
   05322 Systemic lupus erythematosus
    100896470 (TRBV7-9)
   05323 Rheumatoid arthritis
    100896470 (TRBV7-9)
   05320 Autoimmune thyroid disease
    100896470 (TRBV7-9)
   05321 Inflammatory bowel disease (IBD)
    100896470 (TRBV7-9)
   05330 Allograft rejection
    100896470 (TRBV7-9)
   05332 Graft-versus-host disease
    100896470 (TRBV7-9)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100896470 (TRBV7-9)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100896470 (TRBV7-9)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100896470 (TRBV7-9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100896470 (TRBV7-9)
   05170 Human immunodeficiency virus 1 infection
    100896470 (TRBV7-9)
   05162 Measles
    100896470 (TRBV7-9)
   05169 Epstein-Barr virus infection
    100896470 (TRBV7-9)
  09174 Infectious disease: parasitic
   05144 Malaria
    100896470 (TRBV7-9)
   05142 Chagas disease (American trypanosomiasis)
    100896470 (TRBV7-9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set Ig_3 I-set
Motif
Other DBs
NCBI-GeneID: 100896470
NCBI-ProteinID: XP_009001188
Position
8
AA seq 155 aa AA seqDB search
MGKRLLCWVALCVLGADHAGAGVSQDPRHKVTKMGQNVTFRCDPISGHTRLYWYRQTLGQ
SLEFLTYFQNEAQSDKSGLPSDRFFAERTGGSFSTLTIKRTVQGDSAMYLCASSSTTAWH
IRLLPAHKPLGTYFSFQFSEALNKAAALLFSQQEE
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaaaggctcctctgctgggtggccctgtgtgtcctgggggcagatcacgcaggt
gctggagtctcccaagaccccagacacaaggttacaaagatgggacagaatgtaactttc
aggtgtgatccaatttctggacacactcgcctttattggtaccgacagaccctggggcag
agcctagagtttctgacttacttccagaatgaagctcaatcagacaaatcagggctgccc
agtgatcggttctttgcagagaggactgggggatccttctccactctgacgatcaagcgc
acagtgcagggggactcagccatgtatctctgtgccagcagctcaaccacagcatggcac
attcgcctccttcctgctcacaaacccttaggcacttacttctccttccagttctcagaa
gccctgaacaaagcagctgccctgctcttctcccagcaagaagaatga

DBGET integrated database retrieval system