KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100409302Help
Entry
100409302         CDS       T03264                                 

Gene name
SMAD4
Definition
(RefSeq) SMAD family member 4
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04068  FoxO signaling pathway
cjc04110  Cell cycle
cjc04310  Wnt signaling pathway
cjc04350  TGF-beta signaling pathway
cjc04371  Apelin signaling pathway
cjc04390  Hippo signaling pathway
cjc04520  Adherens junction
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04659  Th17 cell differentiation
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc05161  Hepatitis B
cjc05166  Human T-cell leukemia virus 1 infection
cjc05200  Pathways in cancer
cjc05210  Colorectal cancer
cjc05212  Pancreatic cancer
cjc05220  Chronic myeloid leukemia
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Module
cjc_M00679  BMP signaling
cjc_M00680  TGF-beta signaling
cjc_M00681  Activin signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100409302 (SMAD4)
   04350 TGF-beta signaling pathway
    100409302 (SMAD4)
   04390 Hippo signaling pathway
    100409302 (SMAD4)
   04371 Apelin signaling pathway
    100409302 (SMAD4)
   04068 FoxO signaling pathway
    100409302 (SMAD4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100409302 (SMAD4)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100409302 (SMAD4)
   04550 Signaling pathways regulating pluripotency of stem cells
    100409302 (SMAD4)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100409302 (SMAD4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100409302 (SMAD4)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100409302 (SMAD4)
   05212 Pancreatic cancer
    100409302 (SMAD4)
   05225 Hepatocellular carcinoma
    100409302 (SMAD4)
   05226 Gastric cancer
    100409302 (SMAD4)
   05220 Chronic myeloid leukemia
    100409302 (SMAD4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100409302 (SMAD4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100409302 (SMAD4)
   05161 Hepatitis B
    100409302 (SMAD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MH2 MH1 IRF-3
Motif
Other DBs
NCBI-GeneID: 100409302
NCBI-ProteinID: XP_008978080
Ensembl: ENSCJAG00000001910
UniProt: A0A2R8MAR1
Position
13
AA seq 552 aa AA seqDB search
MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITA
ITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFD
LKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSSMMVKDEYVHDFEGQPSLSTEGHSIQ
TIQHPPSNRASTETYSTPALLAPSESNATSTANFPNIPVASTSQPASILGGSHSEGLLQI
ASGPQPGQQQNGFTGQPATYHHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPMPPHPGH
YWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGD
RFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGR
APGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAP
AISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVL
HTMPIADPQPLD
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggacaatatgtctattacgaatacaccaactagtaatgatgcctgtctgagcattgtg
catagtttgatgtgccatagacaaggtggagagagtgaaacatttgcaaaaagagcaatt
gaaagtttggtaaagaagctgaaggaaaaaaaagatgaattggattctttaataacagcc
ataactacaaatggagctcatcctagtaaatgtgttaccatacagagaacattggatggg
agacttcaggtggctggccggaaaggatttcctcatgtgatctatgcccgtctctggagg
tggcctgatcttcacaaaaatgaactaaaacatgttaaatattgtcagtatgcgtttgac
ttaaaatgtgatagtgtctgtgtgaatccatatcactatgaacgagttgtatcacctgga
attgatctctcaggattaacactgcagagtaatgctccatcaagtatgatggtgaaggat
gaatatgttcatgattttgagggacagccatcgttatccactgaaggacattcaattcaa
accatccagcatccaccaagtaatcgcgcatcaacagagacatacagcaccccagctctg
ttagccccatctgagtctaatgctaccagcactgccaactttcccaacattcctgtggct
tccacaagtcagcctgccagtatactggggggcagccatagtgaaggactgttgcagata
gcatcagggcctcagccaggacagcagcagaatggatttactggtcagccagctacttac
catcataacagcactaccacctggactggaagtaggactgcaccatacacacctaatttg
cctcaccaccaaaacggccatcttcagcaccacccgcctatgccgccccatcccggacat
tactggcctgttcacaatgagcttgcattccagcctcccatttccaatcatcctgctcct
gagtattggtgttccattgcttactttgaaatggatgttcaggtaggagagacatttaag
gttccttcaagctgtcctattgttactgttgatggatacgtggacccttctggaggagat
cgcttttgtttgggtcaactctccaatgtccacaggacagaagccattgagagagcaagg
ttgcacataggcaaaggtgtgcagttggaatgtaaaggcgaaggcgatgtttgggtcagg
tgccttagcgaccatgcagtctttgtacagagttactacttagacagagaagctgggcgt
gcacctggagatgctgttcataagatctacccaagtgcatatataaaggtctttgatttg
cgtcagtgtcatcgacagatgcagcagcaggcggccactgcacaagctgcagcagccgcc
caggcagcagctgtggcaggaaacatccctggcccgggatcagtaggtggaatagctcca
gctatcagtctgtcagctgctgccggaatcggtgttgatgaccttcgtcgtttatgcata
ctcaggatgagttttgtgaaaggctggggaccggattacccaagacagagcatcaaagaa
acgccttgctggattgagattcacttacaccgtgccctccagctcctagatgaagtactt
cacaccatgccgattgcagacccacaacctttagactga

DBGET integrated database retrieval system