KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100409392Help
Entry
100409392         CDS       T03264                                 

Gene name
GCK
Definition
(RefSeq) glucokinase
  KO
K12407  glucokinase [EC:2.7.1.2]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00010  Glycolysis / Gluconeogenesis
cjc00052  Galactose metabolism
cjc00500  Starch and sucrose metabolism
cjc00520  Amino sugar and nucleotide sugar metabolism
cjc00524  Neomycin, kanamycin and gentamicin biosynthesis
cjc01100  Metabolic pathways
cjc01200  Carbon metabolism
cjc04910  Insulin signaling pathway
cjc04911  Insulin secretion
cjc04917  Prolactin signaling pathway
cjc04922  Glucagon signaling pathway
cjc04930  Type II diabetes mellitus
cjc04950  Maturity onset diabetes of the young
cjc05230  Central carbon metabolism in cancer
Module
cjc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cjc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100409392 (GCK)
   00052 Galactose metabolism
    100409392 (GCK)
   00500 Starch and sucrose metabolism
    100409392 (GCK)
   00520 Amino sugar and nucleotide sugar metabolism
    100409392 (GCK)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    100409392 (GCK)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100409392 (GCK)
   04910 Insulin signaling pathway
    100409392 (GCK)
   04922 Glucagon signaling pathway
    100409392 (GCK)
   04917 Prolactin signaling pathway
    100409392 (GCK)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    100409392 (GCK)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100409392 (GCK)
   04950 Maturity onset diabetes of the young
    100409392 (GCK)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     100409392 (GCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 100409392
NCBI-ProteinID: XP_002751424
Ensembl: ENSCJAG00000008025
Position
8
AA seq 466 aa AA seqDB search
MAMDVTKNQDQTALTLVEQILAEFQLQEEDLKKVMRRMQKEMDRGLRLETHEEASVKMLP
TYVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEEGQWSVKTKHQMYSIPEDAMTGTA
EMLFDYISECISDFLDKHQMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGN
NVVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDHQCEVGMIVGTGCNACYMEEMQ
NVELVEGDEGRMCVNTEWGAFGDSGELDEFLLEYDRLVDESSANPGQQLYEKLIGGKYMG
ELVRLVLLRLVDENLLFHGEASEQLRTRGAFETRFVSQVESDTGDRKQIYNILSTLGLRP
SATDCDIVRRACESVSTRAAHMCSAGLAGVINRMRESRSEDVMRITVGVDGSVYKLHPSF
KERFHASVRRLTPSCEITFIESEEGSGRGAALVSAVACKKASMLGQ
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggccatggatgtcacaaagaaccaggaccagacagccttgactctggtggagcagatc
ctggcagagttccagctgcaggaggaggacctgaaaaaggtgatgaggcggatgcagaag
gagatggaccgtggcctgaggctggagacccacgaggaggccagtgtgaagatgctgccc
acctatgtgcgctccaccccagaaggctcagaagtcggggacttcctctctctggacctg
ggtggcaccaacttcagggtaatgctggtgaaggtgggagaaggtgaggaggggcagtgg
agtgtgaagaccaaacaccagatgtactccatccccgaggacgccatgaccggcactgct
gagatgctctttgactatatctccgagtgcatctccgacttcctggataagcatcagatg
aagcacaagaagctgcccctgggcttcaccttctcctttcccgtgaggcatgaagacatc
gacaagggcatccttctcaactggaccaagggcttcaaggcctcaggagcagaagggaac
aacgtcgtggggcttctgagagacgccatcaaacggagaggggacttcgaaatggatgtg
gtggcgatggtgaatgacacagtggccacaatgatctcctgttactatgaagaccatcag
tgcgaggtcggcatgattgtgggcacaggctgcaatgcctgctacatggaggagatgcag
aatgtggagctggtggagggggacgagggccgcatgtgcgtcaacaccgagtggggtgcc
ttcggggactccggcgagctggacgagttcctgctggagtatgaccgcctggtggacgag
agctctgcgaaccccggtcagcagctgtatgagaagctcataggcggcaagtacatgggc
gagctggtgcggctggtgctgctcaggctcgtggacgaaaacctgctcttccacggggag
gcctccgagcagctgcgcacaaggggagccttcgagacgcgcttcgtgtcgcaggtggag
agcgacacgggcgaccgcaagcagatctacaacatcctgagcacgctggggctgcgaccc
tcggccaccgactgcgacatcgtgcgccgagcctgtgagagcgtgtctacgcgcgctgcg
cacatgtgctcggcggggctggcgggcgtcatcaaccgcatgcgggagagccgcagcgag
gacgtgatgcgcatcaccgtgggcgtggacggctccgtgtacaagctgcaccccagcttc
aaggagcggttccatgccagcgtgcgccgactgacgcccagctgcgagatcaccttcatc
gagtcagaggagggcagtggccggggcgcagccctggtctcggctgtggcctgtaagaag
gcctctatgctgggccagtga

DBGET integrated database retrieval system