KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100409449Help
Entry
100409449         CDS       T03264                                 

Gene name
TICAM2
Definition
(RefSeq) toll like receptor adaptor molecule 2
  KO
K05409  TRIF-related adaptor molecule
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04064  NF-kappa B signaling pathway
cjc04217  Necroptosis
cjc04620  Toll-like receptor signaling pathway
cjc05133  Pertussis
cjc05161  Hepatitis B
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100409449 (TICAM2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100409449 (TICAM2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100409449 (TICAM2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100409449 (TICAM2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100409449 (TICAM2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100409449 (TICAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIR_2 TIR
Motif
Other DBs
NCBI-GeneID: 100409449
NCBI-ProteinID: NP_001191272
UniProt: U3BR02
Position
2
AA seq 234 aa AA seqDB search
MGIGKSKIDSCPLSLSWGKRHSVDTSPGYQESDSKKSKDLSLCDVAEHNNSTEGPTGKQE
GPQSMEEMLEEAEEEVFLKFVILHAEDDTDEALRVQNLLQDDFGIKPGIIFAEMPCGRQH
LQNLDDAVNGSAWTILLLTENFLRDTWCNFQFYTSLMNSVNRQHKYNSVIPMRPLNNPLP
RERTPFALQTINALEEESRGFPTQVERIFQESVYKTQQTIWKETRNMVQRQFIA
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgggtatcgggaagtctaaaatagattcctgccctctttctctctcttggggtaaaagg
cacagtgtggatacaagtccaggataccaagagtcagattccaagaagtctaaagatctg
tccttgtgtgatgttgctgagcacaacaattcaacagaggggccaacaggaaagcaggag
ggacctcagagcatggaagagatgcttgaagaagctgaagaagaggtgttcctcaaattt
gtgatattgcatgcagaagatgacacagatgaagccctcagagtccagaatctgctacaa
gatgactttggtatcaaacctggaataatcttcgctgagatgccatgtggcagacaacat
ttacagaatttagatgatgctgtaaatggatctgcatggacaatcttattactgactgaa
aattttttaagagatacgtggtgtaatttccagttctatacatccttaatgaactctgtt
aacaggcagcacaaatacaactctgttatacccatgcggcctctgaacaaccccctcccc
cgagaaaggactccgtttgctctccaaaccatcaatgccttagaggaagaaagtcgtggc
tttcctacacaagtagaaagaatttttcaggagtctgtgtataagacacaacaaactata
tggaaagagacaagaaatatggtacaaagacaatttattgcctga

DBGET integrated database retrieval system