KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100409575Help
Entry
100409575         CDS       T03264                                 

Gene name
IL15
Definition
(RefSeq) interleukin 15
  KO
K05433  interleukin 15
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04630  Jak-STAT signaling pathway
cjc04668  TNF signaling pathway
cjc04672  Intestinal immune network for IgA production
cjc05166  Human T-cell leukemia virus 1 infection
cjc05200  Pathways in cancer
cjc05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    100409575 (IL15)
   04668 TNF signaling pathway
    100409575 (IL15)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100409575 (IL15)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    100409575 (IL15)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100409575 (IL15)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100409575 (IL15)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100409575 (IL15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100409575 (IL15)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interleukins
   100409575 (IL15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL15
Motif
Other DBs
NCBI-GeneID: 100409575
NCBI-ProteinID: XP_002745375
Ensembl: ENSCJAG00000002909
UniProt: F7ILX5
Position
3
AA seq 162 aa AA seqDB search
MRISKPHLRSISIQSYLCLLLNSHFLTEAGIHVFILGCFSAALPKTEAIWVDVISDLRRI
QDLIQSIHIDATLYTESDIHPRCKVTAMKCFLLELQVISLESNNTNINDTIENLLILANR
SLSSNGTITESGCKECEELEEKNIKEFLQSFVHIVQMFIYTS
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgagaatttcgaaaccacatttgagaagtatttccattcagtcctacttgtgtttactt
ctaaacagtcattttctaactgaggctggcattcatgtcttcattttgggctgttttagt
gcagcacttcctaaaacagaagccatctgggtggatgtaataagtgatttgagaagaatt
caagatcttattcaatctatacatattgatgctactttatatacggaaagtgatattcat
cccaggtgcaaagtaacagcaatgaagtgctttctcttggagttacaagttatttcactt
gagtccaacaatacaaatattaatgatacaatagaaaatcttctcatcctagcaaacaga
agtttatcttctaatgggactattacagaatctggatgcaaagaatgtgaggaattggag
gaaaaaaatattaaagaatttttgcagagttttgtacatattgtccaaatgttcatctat
acttcttaa

DBGET integrated database retrieval system