KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100409768Help
Entry
100409768         CDS       T03264                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit C-like protein
  KO
K03252  translation initiation factor 3 subunit C
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03013  RNA transport
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100409768
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:cjc03012]
    100409768
Translation factors [BR:cjc03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    100409768
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF-3c_N PCI
Motif
Other DBs
NCBI-GeneID: 100409768
NCBI-ProteinID: XP_017832881
Position
10
AA seq 905 aa AA seqDB search
MKVRDVTKCLEESEPLGEAYGKAKSSADKEGVPWFYIHILADLEDYLNELWEVKEGKKKK
KEKNKNIAKALSTLRQKIRKYNRDFGARITSSKQNPEQFADEDAEKNEEDSEGSSDEGEG
DGEGRVSIATFLEKKSDAPSGESRKFLTKMEDEDEDSEDSEDGEDWDTGSTSSDSDSEDE
EGKETALASRFLKKAPTTDTDEDKKAVEKKREDKHKKHGRKSQRLHEEEEEDDEGGEWER
IRGGVSLVNENPKMFAKGTEISHAVVIKRLNEILQAQGKTGTDRPAHHCWFRLRQKQPGR
RDHRQGKFRIIASHYDYDPSLATYTEPEMWGKCLDCINELMDILLANPNIFVGENILEET
ENLHNADQPLRVCGCILTLVERMDEEFTKIMQNTDPHSQEYVEHLKDEAQVCAIIERVQH
YLEEKGTAEEVCRIHLLRTLHTHCEFGXEAHQPQPTPPERSSKSEQDQAENEGEDSAALM
ERWCKYIHAKDRTDRIRICAILCRIYHHALRSRWYQARDLMLMSHLQGNIQHADPPLWNL
HNRTTVQLGTCALRQGLTKDAHNALLDIQSSGRAKELPGQALLLCSLQERNQEQEKVERR
WQVPFHLHINLQLLGCVYLVSAMLLQIPYMAAHESDAHXRMISKQFHHQLRVGEWQPLLG
PPESIREPVVAASKAMKMGDWKTCXSFIINEKMNKKVWDLFPKADKVRTMLVRKILEESP
RTHLFTYSSVYDSVSTETLSHMFELDLPTVHSIVSKMIINEELMASLDQPMPTVATRRTE
PTAQQNLALQPAEKLGRLVENNERVFDHKQGTYGGYFRDQKDGYRKNEGYMRRGGYRQHQ
SQRPAELPTVSAPRPSNLEVLNHTPVIKGLFKVGKKKKKRGQSCETQPLSCRSNILSREA
VSTLR
NT seq 2718 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttcgtgatgtcaccaagtgcctggaagagtctgagcccctgggagaagcatat
gggaaggccaagagcagtgcggacaaagaaggtgtcccctggttctatatccacatcttg
gctgacctagaggactatcttaatgagctctgggaagttaaggaagggaagaagaagaag
aaggagaagaacaagaacatcgccaaggctttgagcaccctgcgccagaagatccgaaaa
tacaaccgtgattttggggcccgtatcacaagttccaagcagaaccccgagcagtttgca
gatgaagatgctgagaagaatgaggaggattcagaaggctcttcagatgagggtgagggt
gacggtgagggcagagtcagtattgcgactttcttggagaagaaatcggatgctccttct
ggggagagtcgcaagttcctcacaaagatggaggatgaagatgaggactcagaagattct
gaagatggtgaagactgggacacaggctccacatcttccgattctgactcagaggatgaa
gaagggaaagaaaccgcactggcctcaagatttcttaaaaaggcgcccaccacagacaca
gatgaggacaagaaggcagtggagaagaaacgggaggacaaacataagaagcatggcagg
aaatcccagcgcctgcatgaggaggaggaggaggacgatgaaggcggggagtgggaaagg
atccggggtggagtgtccctggtcaacgagaacccaaaaatgtttgccaagggaacggag
atcagccatgctgtcgtcatcaagagactgaatgagatcctacaggcacaaggcaagacg
ggaactgatcgtcctgcccaccactgctggttcagactgcggcagaaacaacctgggaga
cgggatcatcgtcaaggtaagttccgtatcatcgcctcgcactatgactacgaccccagc
ctggcaacctatacggagccagagatgtgggggaagtgcctggactgcatcaacgagctg
atggacatcctgcttgcaaatcccaacatttttgttggagagaatattctggaagagact
gagaacctgcacaatgctgaccagccactgcgtgtctgtgggtgcatcctaactctagtg
gaacgaatggatgaagaattcaccaaaataatgcaaaatactgatcctcactcccaagag
tacgtggagcacctgaaggacgaggcccaggtttgcgccatcatcgagcgtgtgcagcac
tacctggaggagaagggaaccgctgaggaggtctgccgtatccacctgctgcgaaccctg
cacacccactgcgagttcggttaggaggcccatcagccgcagccgaccccgccggagcgc
tcctcaaagtcagagcaagatcaggcagaaaatgagggtgaggactcggccgcgctgatg
gagagatggtgcaagtacatccacgccaaggaccgcacagaccggatccgcatatgcgcc
atcctctgccgcatctaccaccatgctctgcgctcccgctggtaccaggcccgcgacctc
atgctcatgagccacctgcagggcaacattcagcacgcggacccgccactgtggaacctt
cacaaccgcacaacggtgcagctgggcacctgtgccctccgccaaggcctcaccaaggac
gcgcacaacgccctgctggatatccagtccagcggccgggccaaggagcttccgggccag
gccctgctgctgtgcagcctgcaggagcgcaaccaggagcaggagaaggtggagcggcgc
tggcaggtccccttccacctgcacatcaacctgcagctgctggggtgtgtctacctggtg
tctgccatgctcctgcagatcccctacatggccgcacatgagagcgatgcccactgacgc
atgatcagcaagcagttccaccaccagctacgcgtgggcgagtggcagcccctgctgggt
ccccctgagtccataagggaacctgtggttgctgcctctaaggccatgaagatgggtgac
tggaagacctgcnncagtttcatcatcaatgagaagatgaataagaaagtgtgggacctt
ttccccaaggctgacaaagtgcgcaccatgctggttaggaagatcctggaagagtcaccg
aggacccacctcttcacctacagcagtgtctacgactccgtcagcacggagacgctgtca
cacatgttcgagctggatctgcccacggtgcactccatcgtcagcaagatgatcattaat
gaggagctaatggcctctctggaccagccgatgccgacagtggcgacgcgccgcacagag
cccactgcccagcagaacctggctctgcagccggctgagaagctgggacgcctggtggag
aacaacgagcgggtgtttgaccacaagcagggcacctacggcggctacttccgagaccag
aaggacggctaccgcaaaaacgagggctacatgcgccgcggcggctaccgccagcaccag
tcccaacggcctgctgagctccccactgtctctgcgcctagaccatccaaccttgaagtc
ctaaaccacaccccagttattaaaggtctatttaaagtcgggaaaaaaaaaaaaaagaga
ggacagtcttgtgagactcagccactcagctgcagaagtaatattctctccagggaagca
gtgtcaacactgcgctaa

DBGET integrated database retrieval system