KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100409771Help
Entry
100409771         CDS       T03264                                 

Gene name
TIRAP
Definition
(RefSeq) TIR domain containing adaptor protein
  KO
K05403  toll-interleukin 1 receptor (TIR) domain-containing adaptor protein
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04064  NF-kappa B signaling pathway
cjc04620  Toll-like receptor signaling pathway
cjc05133  Pertussis
cjc05152  Tuberculosis
cjc05161  Hepatitis B
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100409771 (TIRAP)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100409771 (TIRAP)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100409771 (TIRAP)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100409771 (TIRAP)
   05152 Tuberculosis
    100409771 (TIRAP)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100409771 (TIRAP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIR_2 TIR
Motif
Other DBs
NCBI-GeneID: 100409771
NCBI-ProteinID: XP_009005337
Ensembl: ENSCJAG00000008886
Position
11
AA seq 271 aa AA seqDB search
MASSPSLPAPGSRPKKPLGKMADWFRQTLLKKPKKMPDSSESAPSDASQPTSQDSSVPPS
HSSVTSPSLPPSQASDSGSIRWSKDYDVCVCHSEEDLVAAQNLVSYLEGSTASLRCFLQL
RDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPWCKYQMLQALTDAPGAEGRTIPLLS
GLSRAAYPPELRFMYYVDGRGPDGGFHQVKEAVMRCKLLQEGEGEWDSATVSDLLWLLGD
SPVACSSKCSLWKRLSGFVSWVPHLLLTHKK
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggcatcatcgccctccctcccagctcctggctcgcggcctaagaagcctctaggcaag
atggctgactggttcaggcagaccctgctgaagaagcccaagaagatgcccgactcctca
gaaagtgcacccagtgatgcttcacagcctacctcacaggatagctccgtacccccaagt
cacagctcagtcacatctcccagcctgccaccctcgcaagcaagtgacagcggcagtatt
cgctggagcaaagactatgacgtctgcgtgtgccacagtgaagaagacctggtggccgcc
cagaacctggtctcctacctggaaggcagcactgccagcctgcgctgcttcctacagctc
cgggatgcaaccccaggtggtgccatcgtgtccgaactgtgccaggcactgagtagtagt
cactgccgcgtgctgctcatcaccccaggcttccttcaggacccctggtgcaagtaccag
atgctgcaggccctgaccgatgccccgggggccgagggccgaaccatccctctgctgtcg
ggcctcagcagagctgcctacccacctgagctccgattcatgtattacgtggatggcagg
ggccctgatggtggctttcaccaagtcaaagaagctgtcatgcgttgtaagctactacag
gagggagaaggggaatgggattcagccacagtatctgatctactttggcttttaggagac
agccctgtagcctgtagttcaaagtgcagcctctggaaaaggctgtctgggtttgtatcc
tgggtcccgcacttattattaacccataaaaagtaa

DBGET integrated database retrieval system