KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100409777Help
Entry
100409777         CDS       T03264                                 

Gene name
ABAT
Definition
(RefSeq) 4-aminobutyrate aminotransferase
  KO
K13524  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00250  Alanine, aspartate and glutamate metabolism
cjc00280  Valine, leucine and isoleucine degradation
cjc00410  beta-Alanine metabolism
cjc00640  Propanoate metabolism
cjc00650  Butanoate metabolism
cjc01100  Metabolic pathways
cjc04727  GABAergic synapse
Module
cjc_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    100409777 (ABAT)
   00650 Butanoate metabolism
    100409777 (ABAT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100409777 (ABAT)
   00280 Valine, leucine and isoleucine degradation
    100409777 (ABAT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100409777 (ABAT)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    100409777 (ABAT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cjc01007]
    100409777 (ABAT)
Enzymes [BR:cjc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     100409777 (ABAT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     100409777 (ABAT)
Amino acid related enzymes [BR:cjc01007]
 Aminotransferase (transaminase)
  Class III
   100409777 (ABAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Tex_N
Motif
Other DBs
NCBI-GeneID: 100409777
NCBI-ProteinID: XP_002755924
Ensembl: ENSCJAG00000017292
UniProt: U3CEZ2
Position
12
AA seq 500 aa AA seqDB search
MASMLLARRLACSFQHSFRLLVPGSRHISQAAAKVDVEFDYDGPLMKTEVPGPRSRELMK
QLNIIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPIGYSHPALLKLIQQPQ
NATTFVNRPALGILPPENFVDKLQESLLSVAPKGMSQLITMACGSCSNENAFKTIFMWYR
SKERGQTGFSQEELETCMINQAPGCPDYSILSFMGAFHGRTMGCLATTHSKAIHKIDIPS
FDWPIAPFPRLSYPLEEFEKENQQEEARCLEEVEDLIVKYRKKKKTVAGIIVEPIQSEGG
DNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFWAHEHWGLDDPADVMTFSKKMM
TGGFFHKEEFRPNAPYRIFNTWLGDPSKNLLLAEVINVIKREDLLNNAAHAGKALLTGLL
DLQARYPQFISRVRGRGTFCSFDTPDESIRNKLILIARNKGVMLGGCGDKSIRFRPTLVF
RDHHAHLFLNIFSDILADFK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcctccatgttgctcgcccggcgcctggcctgcagcttccagcacagcttccgcctg
ctggtgcccggatccagacacattagccaagccgcagccaaagtcgacgtcgaatttgat
tatgatgggcctttgatgaagacggaagtcccagggcctcgatctcgggagttaatgaaa
cagctgaatataattcagaatgcagaggctgtgcattttttctgcaattacgaagagagc
cgaggcaattacctcgtcgatgttgatggcaaccgaatgctggatctttattcccaaatc
tcctctgtccccataggttacagccaccctgccctgctgaaactcatccagcagcctcaa
aatgcgaccacgttcgtcaacagacctgccctggggatcctgcctccggagaactttgtg
gataagctccaggagtccttgctctcagtggctcccaaagggatgtcccagctcatcacc
atggcctgcggctcctgctccaatgaaaatgccttcaagaccatcttcatgtggtaccgg
agcaaggaaagagggcagacaggcttctcccaggaggaactggagacatgcatgattaac
caggcccctgggtgccccgactacagcatcctctccttcatgggcgcattccacgggagg
accatgggttgcttagcaaccacacactccaaagccattcacaagatcgacatcccttcc
tttgactggcccatcgcaccgttcccacggctgagttaccctctggaagagtttgagaaa
gagaatcaacaggaggaggcccgctgtctggaagaggtggaggatctgattgtgaaatat
cggaaaaagaagaagacagtggccgggatcattgtggaacccatccagtccgagggtgga
gacaaccacgcgtccgatgacttctttcggaagctgagagacatcgccaggaagcacggc
tgtgccttcttggtggatgaggtccagaccggaggaggctgcacgggcaagttctgggcc
catgagcactggggcttggatgacccagcagatgtgatgaccttcagcaagaagatgatg
actgggggcttcttccacaaggaggagttcaggcccaatgctccttaccggatcttcaac
acctggctgggggacccatccaagaacctgctgctggctgaggtcatcaacgtcatcaag
cgggaggacctgctaaataacgcagcccatgccgggaaggccctgctcacaggactgctg
gacctccaggcccggtacccccaattcatcagcagggtgagaggacgaggcaccttctgc
tccttcgatactcctgatgaatccatacggaataagctcattttaattgccagaaacaaa
ggtgtgatgttggggggctgcggtgacaaatccattcgtttccgtcccacgttggtcttc
agggatcaccatgctcacctattcctcaatattttcagtgacatcttagcagacttcaag
taa

DBGET integrated database retrieval system