KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100410124Help
Entry
100410124         CDS       T03264                                 

Gene name
SOS2
Definition
(RefSeq) SOS Ras/Rho guanine nucleotide exchange factor 2
  KO
K03099  son of sevenless
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01521  EGFR tyrosine kinase inhibitor resistance
cjc01522  Endocrine resistance
cjc04010  MAPK signaling pathway
cjc04012  ErbB signaling pathway
cjc04014  Ras signaling pathway
cjc04062  Chemokine signaling pathway
cjc04068  FoxO signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04150  mTOR signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04510  Focal adhesion
cjc04540  Gap junction
cjc04630  Jak-STAT signaling pathway
cjc04650  Natural killer cell mediated cytotoxicity
cjc04660  T cell receptor signaling pathway
cjc04662  B cell receptor signaling pathway
cjc04664  Fc epsilon RI signaling pathway
cjc04714  Thermogenesis
cjc04722  Neurotrophin signaling pathway
cjc04810  Regulation of actin cytoskeleton
cjc04910  Insulin signaling pathway
cjc04912  GnRH signaling pathway
cjc04915  Estrogen signaling pathway
cjc04917  Prolactin signaling pathway
cjc04926  Relaxin signaling pathway
cjc05034  Alcoholism
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05163  Human cytomegalovirus infection
cjc05165  Human papillomavirus infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05206  MicroRNAs in cancer
cjc05210  Colorectal cancer
cjc05211  Renal cell carcinoma
cjc05213  Endometrial cancer
cjc05214  Glioma
cjc05215  Prostate cancer
cjc05220  Chronic myeloid leukemia
cjc05221  Acute myeloid leukemia
cjc05223  Non-small cell lung cancer
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
cjc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100410124 (SOS2)
   04010 MAPK signaling pathway
    100410124 (SOS2)
   04012 ErbB signaling pathway
    100410124 (SOS2)
   04630 Jak-STAT signaling pathway
    100410124 (SOS2)
   04068 FoxO signaling pathway
    100410124 (SOS2)
   04072 Phospholipase D signaling pathway
    100410124 (SOS2)
   04151 PI3K-Akt signaling pathway
    100410124 (SOS2)
   04150 mTOR signaling pathway
    100410124 (SOS2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100410124 (SOS2)
   04540 Gap junction
    100410124 (SOS2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100410124 (SOS2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100410124 (SOS2)
   04660 T cell receptor signaling pathway
    100410124 (SOS2)
   04662 B cell receptor signaling pathway
    100410124 (SOS2)
   04664 Fc epsilon RI signaling pathway
    100410124 (SOS2)
   04062 Chemokine signaling pathway
    100410124 (SOS2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100410124 (SOS2)
   04912 GnRH signaling pathway
    100410124 (SOS2)
   04915 Estrogen signaling pathway
    100410124 (SOS2)
   04917 Prolactin signaling pathway
    100410124 (SOS2)
   04926 Relaxin signaling pathway
    100410124 (SOS2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100410124 (SOS2)
  09159 Environmental adaptation
   04714 Thermogenesis
    100410124 (SOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100410124 (SOS2)
   05206 MicroRNAs in cancer
    100410124 (SOS2)
   05205 Proteoglycans in cancer
    100410124 (SOS2)
   05231 Choline metabolism in cancer
    100410124 (SOS2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100410124 (SOS2)
   05225 Hepatocellular carcinoma
    100410124 (SOS2)
   05226 Gastric cancer
    100410124 (SOS2)
   05214 Glioma
    100410124 (SOS2)
   05221 Acute myeloid leukemia
    100410124 (SOS2)
   05220 Chronic myeloid leukemia
    100410124 (SOS2)
   05211 Renal cell carcinoma
    100410124 (SOS2)
   05215 Prostate cancer
    100410124 (SOS2)
   05213 Endometrial cancer
    100410124 (SOS2)
   05224 Breast cancer
    100410124 (SOS2)
   05223 Non-small cell lung cancer
    100410124 (SOS2)
  09165 Substance dependence
   05034 Alcoholism
    100410124 (SOS2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100410124 (SOS2)
   05160 Hepatitis C
    100410124 (SOS2)
   05163 Human cytomegalovirus infection
    100410124 (SOS2)
   05165 Human papillomavirus infection
    100410124 (SOS2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100410124 (SOS2)
   01522 Endocrine resistance
    100410124 (SOS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGEF RasGEF_N RhoGEF PH Histone IQ_SEC7_PH PH_13
Motif
Other DBs
NCBI-GeneID: 100410124
NCBI-ProteinID: XP_009004262
Ensembl: ENSCJAG00000006256
Position
10
AA seq 1272 aa AA seqDB search
MAQPRTVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPSLKEVLGY
KVDYHVSLYIVAVLEYISADILKLAGNYVFNIRHYEISQQDIKVSMCADKVLMDMFDQDD
IGLVSLCEDEPTSSGELNYYDLVRTEIAEERQYLRELNMIIKVFREAFLSDRKLFKPSDI
EKIFSNISDIHELTVKLLGLIEDTVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQDI
LSPEFSEHFSKLMARPAVALHFQSIADGFKEAVRYVLPRLMLVPVYHCWHYFELLKQLKA
CSEEQEDRECLNQAITALLNLQGSMDRIYKQYSPRRRPGDPVCPFYGHQLRSKHLAIKKM
NEIQKNIDGWEGKDIGQCCNEFIMEGPLTRIGAKHERHIFLFDGLMISCKPNHGQTRLPG
YSSAEYRLKEKFVMRKIQICDKEDTCEYKHAFELVSKDENSIIFAAKSAEEKNNWMAALI
SLHYRSTLDRMLDSVLLKEENEQPLRLPSPEVYRFVVKDSEENIVFEDSLQSRSGIPIIK
GGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLLIERFEIPEPEPTDADKLA
IEKGEQPISADLKRFRKEYVQPVQLRILNVFRHWVEHHFYDFERDLELLERLESFISSVR
GKAMKKWVESIAKIIKRKKQAQANGISHNITFESPPPPIEWHISRPGQFETFDLMTLHPI
EIARQLTLLESDLYRKVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVEA
ENFEERVAILSRIIEILQVFQDLNNFNGVLEIVSAVNSVSVYRLDHTFEALQERKRKILD
EAVELSQDHFKKYLVKLKSINPPCVPFFGIYLTNILKTEEGNNDFLKKKGKDLINFSKRR
KVAEITGEIQQYQNQPYCLRIEPDMRRFFENLNPMGSASEKEFTDYLFNKSLEIEPRNCK
QPPRFPRKSTFSLKSPGIRPNTGRHGSTSGTLRGHPTPLEREPCKISFSRIAETELESTV
SAPTSPNTPSTPPVSASSDVSVFLDVDLNSSCGSNSIFAPVLLPHSKSFFSSCGSLHKLS
EEPLIPPPLPPRKKFDHDASNSKGNMKSDDDPPAIPPRQPPPPKVKPRVPVPTGAFDGPL
HSPPPPPPRDPLPDTPPPVPLRPPEHFINCPVNLQPPPLGHLHRDSDWLRDISTCPNSPS
TPPSTPSPRVPRRCYVLSSSQNNLVHPPAPPVPPRQNSSPHLPKLPPKTYKRELSHPPLY
RLPLLENAETPQ
NT seq 3819 nt NT seq  +upstreamnt  +downstreamnt
atggcccagccaaggactgttcaagatgtggaggaacgagttcagaagacctttcctcac
ccaattgataagtgggccattgctgatgcacaatctgccatagaaaaacgaaaacgaaga
aatcctcttttattgcctgtggacaaaatccatccttcattgaaggaggttttagggtac
aaagtggactaccatgtgtccctgtatattgtggctgtactagagtatatctcagctgat
attttaaaattggctggtaattatgttttcaatatccggcattatgaaatatctcagcag
gacattaaagtgtcaatgtgtgcagataaggttttgatggacatgtttgatcaagatgac
ataggtttggtttctctctgtgaagatgaacctacttcttctggtgaattaaactactat
gatctcgtcagaactgaaattgcggaagaaagacagtatctacgggaattaaatatgatc
ataaaagtgtttcgagaagcctttctttctgatagaaagctgtttaaaccttctgatatt
gaaaagatttttagtaacatttcagatatacatgaattgactgtgaaacttttaggtttg
attgaagacacagttgaaatgactgatgaaagcagtcctcatcccttagctggcagctgt
tttgaagatttggcagaagagcaagcatttgatccttatgaaacattgtcacaggatatt
ctttcgccagagtttagtgaacatttcagtaaactgatggccagacctgcagttgctcta
cacttccagtccatagccgatggttttaaagaagcagttcgttatgtccttccgcgtctt
atgctggtgccagtgtatcactgttggcactattttgaattactaaagcaattgaaagca
tgtagtgaagaacaagaagacagagaatgtttgaaccaagctattaccgctctcctgaat
ctccaaggtagcatggaccgaatttacaagcagtattcacctagacgccgacctggagat
cctgtttgccctttttatggtcaccaattaagaagcaaacacctggctatcaaaaaaatg
aatgaaattcagaaaaatattgatggatgggaaggcaaagatattggacagtgttgtaat
gaattcattatggagggaccattgacaagaatcggtgctaaacatgaacgtcatattttt
ctatttgatggcttaatgatcagttgtaagcctaatcatggccagactcggcttccaggt
tatagtagtgcagaatacaggttaaaagaaaaatttgtcatgaggaaaatacagatttgt
gacaaagaagatacttgtgagtacaagcatgcttttgagttagtatccaaagatgagaac
agcataatatttgccgcaaagtctgctgaagaaaaaaataattggatggcagcccttatt
tctcttcattatcgtagtactctagatcgaatgttagattcagtattattgaaagaagaa
aatgaacaaccactgagattaccaagtcctgaagtctatcgttttgtagtaaaagactct
gaggaaaacattgtttttgaagacagtttgcaaagtaggagtggaatccccattattaaa
ggaggaactgtggtgaaattaattgaaaggctgacatatcatatgtatgcagatcccaat
tttgttcgtacttttcttaccacatatcgttcattttgtaaaccacaggaattgctgagc
ttactgattgaacgctttgaaattccagagccagaacctactgatgcagataaattggca
atagagaaaggcgagcagccaatcagtgcagaccttaaaagatttcgcaaggaatacgtc
caaccagtacaacttaggatcttaaatgtatttcggcattgggttgaacatcatttttat
gactttgaaagagatttggaattacttgaaagactagaatccttcatttcaagtgtaaga
gggaaagctatgaagaaatgggtagagtcaattgctaagatcatcaagaggaagaagcaa
gctcaggcaaatggaataagccataatattacctttgaaagtccacctccaccaattgaa
tggcatatcagcagaccaggacagtttgaaacatttgatctcatgacacttcatccaata
gaaattgcacgtcagcttacacttttggagtctgatctctacaggaaagttcaaccttct
gaacttgtagggagtgtgtggaccaaagaagataaagaaataaattctccaaatttatta
aaaatgattcgccataccacaaatctcaccctctggtttgaaaaatgcattgtggaagca
gaaaattttgaagaacgggtggcaatactaagtagaattatagaaattctgcaagttttt
caagatttgaataatttcaatggcgtattggagatagtcagtgcagtaaattcagtgtca
gtatacagactagaccatacctttgaggcattgcaggaaagaaaacggaaaattttggat
gaagccgtggaattaagtcaagatcactttaaaaaatatctggtaaaacttaagtcaatc
aatccaccttgtgtgcctttttttggaatatatttaacaaatattctgaagaccgaagaa
gggaataatgattttttaaaaaagaaagggaaagatttaatcaatttcagtaagaggaga
aaagtagctgaaattactggagaaattcagcagtatcagaatcagccttattgtttacgg
atagaaccagatatgaggagattctttgaaaaccttaaccccatgggaagtgcatctgaa
aaagagtttacagattatttgttcaacaagtcactagaaattgaacctcgaaactgcaaa
cagccacctcgatttcctaggaaatcaactttctccttaaaatctcctggaataaggcct
aacacaggccgacatggctctacctcaggtactttacgaggtcatccaacaccattagaa
agagaaccatgtaaaataagctttagtcggattgctgaaactgagctggaatcaacagtg
tcagcaccaacctctcctaatacaccatctactccaccagtatctgcttcttcagacgtt
agtgtatttttagatgtggatctcaacagctcctgtggcagcaatagcatctttgctcca
gtgcttttgccacattcaaagtctttctttagttcatgtggtagtttacataaactaagt
gaagagccactaattcctcctccacttcctcctcgaaaaaagtttgatcatgatgcttca
aattccaagggaaatatgaaatctgatgatgatcctcctgctattccaccaagacagcct
cctcctccaaaggtaaaacccagagttcctgttcctactggtgcatttgatgggcctcta
catagtccacctccaccaccaccaagagatcctcttcctgatacccctccaccggttccc
cttcggcctccagaacactttataaactgtccagttaatcttcagccacctccactgggg
catcttcacagagattcagactggctgagagacattagtacgtgtccaaattcaccaagc
actcctcctagcacaccctctccaagggtaccacgtcgatgctatgtgctcagttctagt
cagaataatcttgttcatcctccagctccccctgttccaccaaggcagaattcaagccct
catctgccaaaactgccaccaaagacttacaaacgggagctttcgcaccctccattgtac
agactgcctttgctagaaaatgcagaaactccccaatga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100414931Help
Entry
100414931         CDS       T03264                                 

Gene name
SOS1
Definition
(RefSeq) SOS Ras/Rac guanine nucleotide exchange factor 1
  KO
K03099  son of sevenless
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01521  EGFR tyrosine kinase inhibitor resistance
cjc01522  Endocrine resistance
cjc04010  MAPK signaling pathway
cjc04012  ErbB signaling pathway
cjc04014  Ras signaling pathway
cjc04062  Chemokine signaling pathway
cjc04068  FoxO signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04150  mTOR signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04510  Focal adhesion
cjc04540  Gap junction
cjc04630  Jak-STAT signaling pathway
cjc04650  Natural killer cell mediated cytotoxicity
cjc04660  T cell receptor signaling pathway
cjc04662  B cell receptor signaling pathway
cjc04664  Fc epsilon RI signaling pathway
cjc04714  Thermogenesis
cjc04722  Neurotrophin signaling pathway
cjc04810  Regulation of actin cytoskeleton
cjc04910  Insulin signaling pathway
cjc04912  GnRH signaling pathway
cjc04915  Estrogen signaling pathway
cjc04917  Prolactin signaling pathway
cjc04926  Relaxin signaling pathway
cjc05034  Alcoholism
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05163  Human cytomegalovirus infection
cjc05165  Human papillomavirus infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05206  MicroRNAs in cancer
cjc05210  Colorectal cancer
cjc05211  Renal cell carcinoma
cjc05213  Endometrial cancer
cjc05214  Glioma
cjc05215  Prostate cancer
cjc05220  Chronic myeloid leukemia
cjc05221  Acute myeloid leukemia
cjc05223  Non-small cell lung cancer
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
cjc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100414931 (SOS1)
   04010 MAPK signaling pathway
    100414931 (SOS1)
   04012 ErbB signaling pathway
    100414931 (SOS1)
   04630 Jak-STAT signaling pathway
    100414931 (SOS1)
   04068 FoxO signaling pathway
    100414931 (SOS1)
   04072 Phospholipase D signaling pathway
    100414931 (SOS1)
   04151 PI3K-Akt signaling pathway
    100414931 (SOS1)
   04150 mTOR signaling pathway
    100414931 (SOS1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100414931 (SOS1)
   04540 Gap junction
    100414931 (SOS1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100414931 (SOS1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100414931 (SOS1)
   04660 T cell receptor signaling pathway
    100414931 (SOS1)
   04662 B cell receptor signaling pathway
    100414931 (SOS1)
   04664 Fc epsilon RI signaling pathway
    100414931 (SOS1)
   04062 Chemokine signaling pathway
    100414931 (SOS1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100414931 (SOS1)
   04912 GnRH signaling pathway
    100414931 (SOS1)
   04915 Estrogen signaling pathway
    100414931 (SOS1)
   04917 Prolactin signaling pathway
    100414931 (SOS1)
   04926 Relaxin signaling pathway
    100414931 (SOS1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100414931 (SOS1)
  09159 Environmental adaptation
   04714 Thermogenesis
    100414931 (SOS1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100414931 (SOS1)
   05206 MicroRNAs in cancer
    100414931 (SOS1)
   05205 Proteoglycans in cancer
    100414931 (SOS1)
   05231 Choline metabolism in cancer
    100414931 (SOS1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100414931 (SOS1)
   05225 Hepatocellular carcinoma
    100414931 (SOS1)
   05226 Gastric cancer
    100414931 (SOS1)
   05214 Glioma
    100414931 (SOS1)
   05221 Acute myeloid leukemia
    100414931 (SOS1)
   05220 Chronic myeloid leukemia
    100414931 (SOS1)
   05211 Renal cell carcinoma
    100414931 (SOS1)
   05215 Prostate cancer
    100414931 (SOS1)
   05213 Endometrial cancer
    100414931 (SOS1)
   05224 Breast cancer
    100414931 (SOS1)
   05223 Non-small cell lung cancer
    100414931 (SOS1)
  09165 Substance dependence
   05034 Alcoholism
    100414931 (SOS1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100414931 (SOS1)
   05160 Hepatitis C
    100414931 (SOS1)
   05163 Human cytomegalovirus infection
    100414931 (SOS1)
   05165 Human papillomavirus infection
    100414931 (SOS1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100414931 (SOS1)
   01522 Endocrine resistance
    100414931 (SOS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH PH_10 IQ_SEC7_PH PH_13
Motif
Other DBs
NCBI-GeneID: 100414931
NCBI-ProteinID: XP_008979072
Ensembl: ENSCJAG00000015029
Position
14
AA seq 1333 aa AA seqDB search
MQAQQLPYEFFSEENAPKWRGLLVPALKKVQGQVHPTLESNDDALQYVEELILQLLNMLC
QAQPRSASDVEERVQKSFPHPIDKWAIADAQSAIEKRKRRNPLSLPVEKIHPLLKEVLGY
KIDHQVSVYIVAVLEYISADILKLVGNYVRNIRHYEITKQDIKVAMCADKVLMDMFHQDV
EDINILSLTDEEPSTSGEQTYYDLVKAFMAEIRQYIRELNLIIKVFREPFVSNSKLFSAN
DVENIFSRIVDIHELSVKLLGHIEDTVEMTDEGSPHPLVGSCFEDLAEELAFDPYESYAR
DILRPGFHDRFLSQLSKPGAALYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELLKQL
EEKSEDQEDKECLKQAITALLNVQSGMEKICSKSLAKRRLSESACRFYSQQMKGKQLAIK
KMNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGQPRL
PGASNAEYRLKEKFFMRKVQINDKDDTNEYKHAFEIILKDENSVIFSAKSAEEKNNWMAA
LISLQYRSTLERMLDVTMLQEEKEEQMRLPSADVYRFAEPDSEENIIFEENMQPKAGIPI
IKAGTVIKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLIIERFEIPEPEPTEADR
IAIENGDQPLSAELKRFRKEYIQPVQLRVLNVCRHWVEHHFYDFERDADLLQRMEEFIGT
VRGKAMKKWVESITKIIQRKKIARDNGPGHNITFQSSPPTVEWHISRPGHIETFDLLTLH
PIEIARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIV
ETENLEERVAVVSRIIEILQVFQELNNFNGVLEVVSAMNSSPVYRLDHTFEQIPSRQKKI
LEEAHELSEDHYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNPEVLKRHGKELINFSK
RRKVAEITGEIQQYQNQPYCLRVESDIKRFFENLNPMGNSMEKEFTDYLFNKSLEIEPRN
PKPLPRFPKKYSYPLKSPGVRPSNPRPGTMRHPTPLQQEPRKISYSRIPESETESTASAP
NSPRTPLTPPPASGASSTTDVCSVFDSDHSSPFHSSNDTVFIQVTLPYGPRSASVSSISL
TKGTDEMPVPPPVPPRRRPESAPAESSPSKIMSKHLDSPPAIPPRQPTSKAYSPRYSISD
RTSISDPPDSPPLLPPREPVRTPDVFSSSPLHLQPPPLGKKSDHGNAFFPNSPSPFTPPP
PQTPSPHGTRRHLPSPPLTQEVDLHSIAGPPVPPRQSTSQHIPKLPPKTYKREHTHPSMH
RDGPPLLENAHSS
NT seq 4002 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcgcagcagctgccctacgagtttttcagcgaagagaacgcgcccaagtggcga
ggactgctggtgcctgccctgaaaaaggtccaggggcaagttcatcctactcttgagtct
aatgatgatgctcttcagtatgttgaagaattaattttgcagttattaaatatgctatgc
caagctcagccccgaagtgcttcagatgtagaggaacgtgttcaaaaaagtttccctcat
ccaattgataagtgggcaatagctgatgcccaatcagctattgaaaagaggaagcgaaga
aaccctttatctctcccagtagaaaaaattcatcctttattaaaggaggtcctaggttat
aaaattgaccaccaggtttctgtttacatagtagcagtcttagaatacatttctgcagac
attttaaagctggttgggaattatgtaagaaatatacggcattatgaaattacaaaacaa
gatattaaagtggcaatgtgtgctgacaaggtattgatggatatgtttcatcaagatgta
gaagatattaatatattatctttaactgatgaagaaccttccacttcaggagaacaaact
tactatgatttggtaaaagcatttatggcagaaattcgacaatatataagggaactaaat
ctaattataaaagtttttagagagccttttgtctccaattcaaaattgttttcagctaat
gatgtagaaaatatatttagtcgtatagtagatatacatgaacttagtgtaaagttactg
ggccatatagaagatacagtagaaatgacagatgaagggagtccccatccactagtagga
agctgctttgaagacttagcagaggaactggcatttgatccatatgaatcgtatgctcga
gatattttgcggcctggttttcatgatcgtttccttagtcagttatcgaagcctggggca
gcactttatttgcagtcaataggtgaaggtttcaaagaagctgttcaatatgttttaccc
aggctgcttctggctcctgtttaccactgtctccattattttgaacttttgaagcagtta
gaagaaaaaagtgaagatcaagaagacaaggaatgtttaaaacaagcaataacagctttg
cttaatgttcagagtggtatggaaaaaatttgttctaaaagtcttgcaaaacgaagactg
agtgaatctgcatgtcggttttatagtcaacaaatgaaggggaaacaactagcaatcaag
aaaatgaacgagattcagaagaatattgatggttgggagggaaaagacattggacagtgt
tgcaatgaatttataatggaaggaactcttacacgtgtaggagccaaacatgagagacac
atatttctctttgatggcttaatgatttgctgtaaatcaaatcatgggcagccaagactt
cctggtgctagcaatgcagaatatcgtcttaaagaaaagttttttatgcgaaaggtacaa
attaatgataaagatgacaccaatgaatacaagcatgcttttgaaataattttaaaagat
gaaaatagtgttatattttctgccaagtcagctgaagaaaaaaacaactggatggcagca
ttgatatctttacagtaccggagtacattggaaaggatgcttgatgtaacaatgctacag
gaagagaaagaggagcagatgaggctgcctagtgctgatgtttatagatttgcagagcct
gactctgaagagaatattatatttgaagagaacatgcagcccaaggctggaattccaatt
atcaaagcaggaactgttattaaacttatagagaggcttacataccatatgtatgcagat
cccaattttgttcggacatttcttacaacatacagatccttttgcaaacctcaagaacta
ctgagtcttataatagaaaggtttgaaattccagagcctgagccaacagaagctgatcgc
atagctatagagaatggagatcaacctttgagtgcagaattaaaaagatttagaaaagaa
tatatacagcctgtgcagcttcgagtattaaatgtatgtcggcactgggtagagcaccac
ttctatgattttgaaagagatgcagatcttttacaacgaatggaagaatttattggaaca
gtaagaggtaaagcaatgaaaaaatgggttgaatccatcactaaaataatccaaaggaaa
aaaattgcaagagacaatggaccaggtcataatattacatttcagagttcacctcccaca
gttgagtggcatataagcagacctgggcacatagagacttttgacctgctcaccttacac
ccaatagaaattgctcgacaactcactttacttgaatcagatctataccgagctgtacag
ccatcagaattagttggaagtgtgtggacaaaagaagacaaagaaattaactctcctaat
cttctgaagatgattcgacataccaccaacctcactctatggtttgagaaatgtattgta
gaaactgaaaatttggaagaaagagtagctgtggtgagtcgaataattgagattctacaa
gtctttcaagagctgaacaactttaatggtgtccttgaagttgtcagtgccatgaattca
tcacctgtttacagattagaccacacatttgagcaaataccaagtcgccagaagaaaatt
ttagaagaagctcatgaattgagtgaagatcactataagaaatatttggcaaaactcagg
tctattaatccaccatgtgtgcctttctttggaatttatctcactaatatcttgaaaaca
gaagaaggcaaccctgaggtcctaaaaagacatggaaaagagcttataaactttagcaaa
aggaggaaagtagcagaaataacaggagagatccagcagtaccaaaatcagccttactgt
ttacgagtagaatcagatatcaaaaggttctttgaaaacttgaatccaatgggaaatagc
atggaaaaagaatttacagattatcttttcaacaaatccctagaaatagaaccacgaaac
cctaagcctctcccaagatttccaaaaaaatatagctatcccctaaaatctcctggtgtt
cgtccatcaaacccaagaccaggtaccatgaggcatcccacacctcttcagcaggagcca
aggaaaattagttatagtaggatccctgaaagtgaaacagaaagtacggcatctgcacca
aattctccaagaacaccgttaacacctccgcctgcttctggtgcttccagtaccacagat
gtttgcagtgtatttgattccgatcattcgagcccttttcactcaagcaatgataccgtc
tttatccaagtcacactgccctatggcccaagatctgcttctgtatcatctataagttta
accaaaggcacggatgaaatgcctgtccctcctcctgttcctccacgaagacgaccagaa
tctgccccagcagaatcttcaccatctaagattatgtctaagcatttggacagcccccca
gccattcctcctaggcaacccacatcaaaagcctattcaccacggtattcaatatcagac
cggacttctatatcagatcctcctgatagccctcccttattaccaccacgagaacctgtg
aggacacctgatgttttctcaagctcaccactacatctccaacctccccctttgggcaaa
aaaagtgatcatggcaatgccttcttcccaaatagcccctccccctttacaccacctcct
cctcaaacaccttctcctcacggcacaagaaggcatctgccatcaccaccattgacacaa
gaagtggaccttcattccattgctgggccgcctgttcctccacgacaaagcacttctcaa
cacatccctaaactccctccaaaaacttacaaaagggagcacacacacccatccatgcac
agagatggaccaccactgttggagaatgcccattcttcctga

DBGET integrated database retrieval system