KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100410164Help
Entry
100410164         CDS       T03264                                 

Gene name
CSF2
Definition
(RefSeq) colony stimulating factor 2
  KO
K05427  granulocyte-macrophage colony-stimulating factor
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04630  Jak-STAT signaling pathway
cjc04640  Hematopoietic cell lineage
cjc04650  Natural killer cell mediated cytotoxicity
cjc04657  IL-17 signaling pathway
cjc04660  T cell receptor signaling pathway
cjc04664  Fc epsilon RI signaling pathway
cjc04668  TNF signaling pathway
cjc05132  Salmonella infection
cjc05146  Amoebiasis
cjc05166  Human T-cell leukemia virus 1 infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05202  Transcriptional misregulation in cancer
cjc05221  Acute myeloid leukemia
cjc05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    100410164 (CSF2)
   04668 TNF signaling pathway
    100410164 (CSF2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100410164 (CSF2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100410164 (CSF2)
   04650 Natural killer cell mediated cytotoxicity
    100410164 (CSF2)
   04660 T cell receptor signaling pathway
    100410164 (CSF2)
   04657 IL-17 signaling pathway
    100410164 (CSF2)
   04664 Fc epsilon RI signaling pathway
    100410164 (CSF2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100410164 (CSF2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100410164 (CSF2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100410164 (CSF2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100410164 (CSF2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100410164 (CSF2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100410164 (CSF2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100410164 (CSF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cjc03019]
    100410164 (CSF2)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100410164 (CSF2)
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100410164 (CSF2)
Messenger RNA biogenesis [BR:cjc03019]
 Eukaryotic Type
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     100410164 (CSF2)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  CSF and other factors
   100410164 (CSF2)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate/Haparin
  Cytokines
   100410164 (CSF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GM_CSF Hormone_1
Motif
Other DBs
NCBI-GeneID: 100410164
NCBI-ProteinID: XP_002744657
Ensembl: ENSCJAG00000012924
UniProt: B0KWQ4
Position
2
AA seq 144 aa AA seqDB search
MWLQNLLLLGTVAGSISAPTHLPSPDTQPSKHVNAIQEAQRLLNLSRDTAPETNETVEVV
SEMFDRQEPTCLQTRLELYKESLWGSLTKLKGLLTMIASHYKQHCPPTLETSCATKIITF
ESFKENLKDFLLAIPVDCWDPVQE
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgtggctgcagaacctgctgctcttgggcactgtggccggcagcatctctgcacctacc
cacttgcccagccccgacacacagccctcgaagcatgtgaatgccatccaggaggcccag
cgtctcctgaacctgagtagagacactgctcctgagacaaatgaaacagtagaagtggtc
tcagaaatgtttgaccgccaggagccgacctgcctacagacccgcctggagctgtacaag
gaaagcctgtggggtagcctcaccaagctcaagggactcttgaccatgatagccagccac
tacaagcagcactgccccccaaccctggaaacttcctgtgcaaccaagattatcaccttt
gaaagtttcaaagagaacctgaaggactttctgcttgccatccctgttgactgctgggat
ccagtccaggagtga

DBGET integrated database retrieval system