KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100410529Help
Entry
100410529         CDS       T03264                                 

Gene name
IL3, IL-3, MCGF
Definition
(RefSeq) interleukin 3
  KO
K04736  interleukin 3
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04151  PI3K-Akt signaling pathway
cjc04210  Apoptosis
cjc04630  Jak-STAT signaling pathway
cjc04640  Hematopoietic cell lineage
cjc04664  Fc epsilon RI signaling pathway
cjc05200  Pathways in cancer
cjc05202  Transcriptional misregulation in cancer
cjc05221  Acute myeloid leukemia
cjc05310  Asthma
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    100410529 (IL3)
   04151 PI3K-Akt signaling pathway
    100410529 (IL3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100410529 (IL3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100410529 (IL3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100410529 (IL3)
   04664 Fc epsilon RI signaling pathway
    100410529 (IL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100410529 (IL3)
   05202 Transcriptional misregulation in cancer
    100410529 (IL3)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100410529 (IL3)
  09163 Immune disease
   05310 Asthma
    100410529 (IL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100410529 (IL3)
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100410529 (IL3)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interleukins
   100410529 (IL3)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate/Haparin
  Cytokines
   100410529 (IL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL3
Motif
Other DBs
NCBI-GeneID: 100410529
NCBI-ProteinID: XP_002744658
Ensembl: ENSCJAG00000012921
UniProt: Q28334 B0KWQ3
Position
2
AA seq 142 aa AA seqDB search
MSHLPILLLLLLVSPGLQAAPTQTMPLKTTQVNCSNLREEIVTLLNQPPLASSNFNNLNR
EDQRILMKPNLRKPNLEAFQKAVKSLQNAAAIESNLKDLPVCLPTATNAATQHPIRIKDG
DWNDFQMKLKFYLKTLEIKQPQ
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgagccacctgcccatcctgctcctcctactcctggtcagccctggacttcaagctgcc
ccaacccagacaatgcccttgaagacaactcaggttaactgctctaacttgagggaggaa
attgtaacactcctaaaccagccacctttggcttcatcaaacttcaacaacttaaacagg
gaagaccaacgtattctgatgaaaccaaaccttcgaaagccaaacctggaagcattccag
aaggccgtcaagagtttacagaatgcagcagcaatcgagagcaatcttaaggatctccca
gtatgcctgcccacagccacgaatgcagccacgcaacatccaatccgtattaaggacggt
gactggaatgacttccagatgaaactgaagttctatttgaaaacccttgagattaagcag
cctcaatag

DBGET integrated database retrieval system