KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100410584Help
Entry
100410584         CDS       T03264                                 

Gene name
LCK
Definition
(RefSeq) LCK proto-oncogene, Src family tyrosine kinase
  KO
K05856  lymphocyte cell-specific protein tyrosine kinase [EC:2.7.10.2]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04064  NF-kappa B signaling pathway
cjc04380  Osteoclast differentiation
cjc04650  Natural killer cell mediated cytotoxicity
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc04660  T cell receptor signaling pathway
cjc05166  Human T-cell leukemia virus 1 infection
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cjc05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100410584 (LCK)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100410584 (LCK)
   04660 T cell receptor signaling pathway
    100410584 (LCK)
   04658 Th1 and Th2 cell differentiation
    100410584 (LCK)
   04659 Th17 cell differentiation
    100410584 (LCK)
  09158 Development
   04380 Osteoclast differentiation
    100410584 (LCK)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100410584 (LCK)
  09163 Immune disease
   05340 Primary immunodeficiency
    100410584 (LCK)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100410584 (LCK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100410584 (LCK)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cjc03036]
    100410584 (LCK)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100410584 (LCK)
Protein kinases [BR:cjc01001]
 Non-receptor tyrosine kinases
  SRC family
   100410584 (LCK)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100410584 (LCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Haspin_kinase Kdo
Motif
Other DBs
NCBI-GeneID: 100410584
NCBI-ProteinID: XP_008999072
Position
7
AA seq 249 aa AA seqDB search
MGYYNEHTKVAVKXLKQGSMSPDAFLAEANLMKQLQHQRLVRLYAVVTQEPIYIITEYME
NGSLVDFLKTPSGIKLTINKLLDMAAQIAEGMAFIEERNYIHRDLRAANILVSDTLSCKI
ADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIKSDVWSFGILLTEIVTHGRIP
YPGMTNPEVIQNLERGYRMVRPDNCPEELYHLMMLCWKERPEDRPTFDYLRSVLEDFFTA
TEGQYQPQP
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggggtactacaacgagcacacaaaggtggcggtgaagnagctgaagcagggcagcatg
tccccggatgctttcctggcggaggctaacctcatgaagcagctgcaacaccagcggctg
gttcgcctctacgctgtggtcacccaggagcccatctacatcatcactgaatacatggag
aatgggagtctagtggattttctcaagaccccttcaggtatcaagttgaccatcaacaaa
ctcttggacatggcagcccaaattgcagaaggcatggcattcattgaagagcggaattat
attcatcgtgaccttcgggccgccaacattctagtgtctgacacgctgagctgcaagatt
gcagactttggcctagcacgcctcattgaggacaacgagtacacagccagggagggggcc
aagtttcccattaagtggacagcaccagaagccattaactacggaacattcaccatcaag
tcggatgtgtggtcttttggaatcctgctgacggaaattgtcacccatggccgcatccct
tacccagggatgaccaaccctgaggtgattcagaacctggagcgaggttaccgcatggtg
cgccctgacaactgtccagaggagctgtaccacctcatgatgctgtgttggaaggagcgc
ccagaggaccggcccacctttgactacctgcgcagtgtgctggaggacttcttcacagcc
acagagggccaataccagcctcagccttga

DBGET integrated database retrieval system