KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100410616Help
Entry
100410616         CDS       T03264                                 

Gene name
FADD
Definition
(RefSeq) Fas associated via death domain
  KO
K02373  FAS-associated death domain protein
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01524  Platinum drug resistance
cjc04210  Apoptosis
cjc04215  Apoptosis - multiple species
cjc04217  Necroptosis
cjc04620  Toll-like receptor signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc04622  RIG-I-like receptor signaling pathway
cjc04657  IL-17 signaling pathway
cjc04668  TNF signaling pathway
cjc05010  Alzheimer disease
cjc05142  Chagas disease (American trypanosomiasis)
cjc05152  Tuberculosis
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05165  Human papillomavirus infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100410616 (FADD)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100410616 (FADD)
   04215 Apoptosis - multiple species
    100410616 (FADD)
   04217 Necroptosis
    100410616 (FADD)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100410616 (FADD)
   04621 NOD-like receptor signaling pathway
    100410616 (FADD)
   04622 RIG-I-like receptor signaling pathway
    100410616 (FADD)
   04657 IL-17 signaling pathway
    100410616 (FADD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100410616 (FADD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100410616 (FADD)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100410616 (FADD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100410616 (FADD)
   05162 Measles
    100410616 (FADD)
   05164 Influenza A
    100410616 (FADD)
   05161 Hepatitis B
    100410616 (FADD)
   05160 Hepatitis C
    100410616 (FADD)
   05168 Herpes simplex virus 1 infection
    100410616 (FADD)
   05163 Human cytomegalovirus infection
    100410616 (FADD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100410616 (FADD)
   05169 Epstein-Barr virus infection
    100410616 (FADD)
   05165 Human papillomavirus infection
    100410616 (FADD)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    100410616 (FADD)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100410616 (FADD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DED Death EAL
Motif
Other DBs
NCBI-GeneID: 100410616
NCBI-ProteinID: XP_002755691
Position
11
AA seq 284 aa AA seqDB search
MRGSRSSREITVERVPRWVSGSGFGTGVPGRGRARAEPKPWAGGQVARPGQGRRAEDSGR
AEEDRAGPQPRPPAGSAMDPFLVLLHSVSSGLSSSELTELKFLCLGRVGKRKLERVQSGL
DLFSVLLEQNDLEPGRTELLRELLASLRRHDLLRRLDDFEAGAAPGAAPGEEDLGAAFDL
ICDHVGKDWKRLARQLKVSDAKIDSIEDRHPRNLTERVRESLRIWKNTEKENATVAYLVG
ALRACQMNLVADLVEEVQQARELQRSGAVSPTSWNSDASTSEAS
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgggtcccggagttctcgcgagataacggtcgaaagggtgccacggtgggtttcc
ggtagtggatttggcaccggagtgccgggccgggggcgagcgcgggcggagcctaagccg
tgggccggtgggcaagtggcgagacctggccagggccggcgagccgaggacagcgggcgc
gcggaggaggatcgggcggggccgcagccccggccgcctgcaggcagcgccatggacccg
ttcctggtgctgctgcactcggtgtcgtccggcctgtcgagcagcgagctgaccgagctc
aagttcctgtgcctcgggcgcgtgggcaagcgcaagctggagcgcgtgcagagcggcctg
gacctcttctccgtgctgctggagcagaacgacctggagcccgggcgcaccgagctgctg
cgcgagctgctcgcctccctgcggcgccacgacctgctgcggcgcctggacgacttcgag
gcgggggcggcgcccggggccgcgccgggggaagaagacctgggtgcagcatttgacctc
atatgtgatcatgtggggaaagattggaaaagacttgctcgtcagctcaaagtctcagac
gccaagatcgacagcatcgaggacagacacccccgcaacctgacggagcgcgtgagagag
tcgctgagaatctggaagaacacagagaaggagaacgcgacagtggcctacctggtgggg
gctctccgggcctgccagatgaacctggtggctgacctcgtggaagaggttcagcaggcc
cgggagctccagaggagtggggccgtgtccccgacgtcgtggaactcggacgcatccacc
tccgaagcgtcgtga

DBGET integrated database retrieval system