KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100410846Help
Entry
100410846         CDS       T03264                                 

Gene name
PGAM5
Definition
(RefSeq) PGAM family member 5, mitochondrial serine/threonine protein phosphatase
  KO
K15637  serine/threonine-protein phosphatase PGAM5 [EC:3.1.3.16]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04137  Mitophagy - animal
cjc04217  Necroptosis
cjc04668  TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100410846 (PGAM5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100410846 (PGAM5)
  09143 Cell growth and death
   04217 Necroptosis
    100410846 (PGAM5)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100410846 (PGAM5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 100410846
NCBI-ProteinID: XP_017832010
Ensembl: ENSCJAG00000012964
Position
9
AA seq 289 aa AA seqDB search
MAFRQALQLAACGLAGGSAAVLFSAVAVGKPRAGGDAEPRPAEPPAWAGGARPSPGVWDP
NWDRREPLSLINLRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSQEKDRTL
TPLGREQAELTGLRLASLGLKFNKIVHSSMTRAVETTDIISRHLPGVCKVSTDLLREGAP
IEPDPPVSHWKPEAVQYYEDGARIEAAFRNYIHRADARQEEDSYEIFICHANVIRYIVCR
ALQFPPEGWLRLSLNNGSITHLVIRPNGRVALRTLGDTGFMPPDKITRS
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggcgttccggcaggcgctgcagctggcggcctgcgggctggcaggaggctcggcggcc
gtgctcttctcggccgtggcggtaggaaagccgcgtgcgggcggggacgcggaaccacgt
ccggctgagccgccggcctgggcggggggcgcgcggccgagccccggcgtctgggacccc
aactgggacaggcgagaaccactgtctctgatcaacctgcggaagaggaacgtggaatct
ggggaagaggagctggcgtctaagctggaccactacaaagcgaaggccacacggcacatc
ttcctcattaggcactcccagtaccatgtggatggttcccaggagaaggaccgcactctg
accccgctgggtcgggagcaggctgaactcactgggctccgcctcgcaagtctggggttg
aagtttaataaaatcgtccattcctctatgacccgagctgtagagaccactgacatcatc
agccggcacctgccaggcgtctgcaaagtcagcacagacctgctacgggaaggcgccccc
atcgagccggacccacctgtgtctcactggaagccagaagctgtgcagtattacgaagat
ggagcccggatcgaggccgccttccggaactatatccaccgggcagacgccaggcaggag
gaggacagttatgagatcttcatctgtcacgccaacgtcatccgctacattgtgtgcaga
gcactgcagttccccccggaaggctggctccggctctccctcaacaacggcagcatcacc
cacctagtcatccgacccaacggccgagttgcactcaggaccctcggggacacagggttc
atgccccccgacaaaatcacccggtcctga

DBGET integrated database retrieval system