KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100411012Help
Entry
100411012         CDS       T03264                                 

Definition
(RefSeq) heat shock protein HSP 90-alpha-like
  KO
K04079  molecular chaperone HtpG
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04141  Protein processing in endoplasmic reticulum
cjc04151  PI3K-Akt signaling pathway
cjc04217  Necroptosis
cjc04612  Antigen processing and presentation
cjc04621  NOD-like receptor signaling pathway
cjc04657  IL-17 signaling pathway
cjc04659  Th17 cell differentiation
cjc04914  Progesterone-mediated oocyte maturation
cjc04915  Estrogen signaling pathway
cjc05200  Pathways in cancer
cjc05215  Prostate cancer
cjc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100411012
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100411012
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100411012
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100411012
   04612 Antigen processing and presentation
    100411012
   04659 Th17 cell differentiation
    100411012
   04657 IL-17 signaling pathway
    100411012
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100411012
   04914 Progesterone-mediated oocyte maturation
    100411012
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100411012
  09162 Cancer: specific types
   05215 Prostate cancer
    100411012
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100411012
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cjc01009]
    100411012
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cjc03110]
    100411012
   04131 Membrane trafficking [BR:cjc04131]
    100411012
   03051 Proteasome [BR:cjc03051]
    100411012
   03029 Mitochondrial biogenesis [BR:cjc03029]
    100411012
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100411012
Protein phosphatases and associated proteins [BR:cjc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100411012
Chaperones and folding catalysts [BR:cjc03110]
 Heat shock proteins
  HSP90
   100411012
Membrane trafficking [BR:cjc04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    100411012
Proteasome [BR:cjc03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    100411012
Mitochondrial biogenesis [BR:cjc03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    100411012
Exosome [BR:cjc04147]
 Exosomal proteins
  Proteins found in most exosomes
   100411012
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP90 HATPase_c_3 HATPase_c LOH1CR12 DUF1198
Motif
Other DBs
NCBI-GeneID: 100411012
NCBI-ProteinID: XP_008981783
Position
17
AA seq 736 aa AA seqDB search
MPEETQTQDQPMEEKEVETFAFQAEIAQLMSLIINTFYSNKEIFLXELIANSSDALDKIR
YESLKDPSKLDSGKELHINLMPNKQDRTLTIVDTGIGMANADLINNLSTMAKSGTKAFME
ALQAGADIFTIGQFGVGFYFAYLVAEKVTVITKHKDDEQYAWESSAGGLFTVRTDTYFCG
EPMGRGTKVILPLKEDQTEYLEEQRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAEE
KEDKEEEKEKEEKESEDKPEIEDVGSDEEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPI
WTRNPDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRK
KKNNIKLYVRRVFIMDNCEELIPEYXNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNL
VKKCLELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVS
LKDYCTRMKENQKHIYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEF
EGKTLVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSP
CCIVTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKND
KSVKDLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDPTADDTSAAVTEEM
PPLEGDDDTSRMEEVD
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaggaaacccagacccaagaccaaccaatggaggagaaggaggtggagacgttc
gcctttcaggcagaaattgctcagttgatgtcactgatcatcaatactttctattcgaac
aaagagatctttctgtgagagctcattgcaaattcctcagatgccttggacaaaatccgg
tatgagagcttgaaggatcccagtaaactggactctgggaaagagctgcatattaacctt
atgccgaacaaacaagatcgaaccctcactattgtggatactggaattggaatggccaat
gctgacttgattaataaccttagtactatggccaagtctgggaccaaagcattcatggaa
gctttgcaggctggtgcagatatctttacaattggccagtttggtgttggtttttatttt
gcttatttggttgctgagaaagtaacagtgatcaccaaacataaagatgatgagcagtat
gcctgggagtcctcagcagggggattattcacagtgaggacagacacctacttctgcggt
gaacctatgggtcgtggaaccaaggttatcctacccctgaaggaagaccaaactgagtac
ttggaggaacaaagaataaaggagattgtgaagaaacattctcagtttattggctatccc
attactctttttgtggagaaggaacgtgataaagaagtcagtgatgatgaggctgaagaa
aaggaagataaagaagaagaaaaagagaaagaagagaaagagtctgaagataaacctgaa
attgaagatgttggttctgatgaagaagaagaagaaaaaaaggatggtgacaagaagaag
aagaagaagattaaggaaaagtacatcgatcaagaagaactcaacaaaacaaagcccatc
tggaccagaaatcccgacgatattactaatgaggagtatggagaattctacaagagcttg
accaatgactgggaagatcacttggcagtgaagcatttttcagttgaaggacagttggaa
ttcagagcccttctatttgtcccacgacgtgctccttttgacctgtttgaaaacagaaag
aaaaagaataacatcaagttgtatgtacgcagagttttcatcatggataactgtgaggaa
ctaatccctgaatattgaaacttcattagaggggtggtagactcagaggatctccctcta
aatatttcccgtgagatgttgcaacaaagcaagattttgaaagttatcaggaagaatctg
gtcaaaaaatgcttagaactcttcactgaactggcagaagataaagagaactacaagaag
ttctatgagcagttctctaaaaacataaagcttggaatacatgaagactctcaaaatcgg
aagaagctttcagagctgttgagatactacacatctgcctctggtgatgagatggtatct
ctcaaagactactgcaccagaatgaaggaaaaccagaaacatatctattatatcacaggt
gagaccaaggaccaagtagctaactcagcgtttgtggaacgtcttcgaaagcatggctta
gaagtgatctatatgattgagcccattgatgagtactgtgtccaacagctgaaggaattt
gaggggaagactttagtgtcagtcaccaaagagggcttggaacttccagaggatgaagaa
gagaaaaagaaacaggaagagaagaaaacaaagtttgagaacctctgcaaaatcatgaaa
gacatactggagaaaaaggttgaaaaggtggttgtgtcaaaccgattggtgacgtctcca
tgctgtattgtcacaagcacatatggctggacagcaaacatggagagaatcatgaaagct
caagccctgagagacaactcaacaatgggttacatggcagcaaagaaacacctggagata
aaccctgaccattccatcatcgagaccttaaggcaaaaggcggaggctgataagaacgac
aagtctgtgaaggatctggtcatcttgctttatgaaaccgctctcctgtcttcaggcttc
agtctggaggatccccagacacatgctaacaggatctacaggatgatcaaacttggtcta
ggtattgatgaagatgaccctactgctgatgacaccagtgcagctgtaactgaagaaatg
ccacccctcgaaggagatgacgacacgtcacgcatggaagaagtagactaa

DBGET integrated database retrieval system