KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100411258Help
Entry
100411258         CDS       T03264                                 

Gene name
PPARGC1A
Definition
(RefSeq) PPARG coactivator 1 alpha
  KO
K07202  alpha peroxisome proliferator-activated receptor gamma coactivator 1-alpha
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04152  AMPK signaling pathway
cjc04211  Longevity regulating pathway
cjc04371  Apelin signaling pathway
cjc04714  Thermogenesis
cjc04910  Insulin signaling pathway
cjc04920  Adipocytokine signaling pathway
cjc04922  Glucagon signaling pathway
cjc04931  Insulin resistance
cjc05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100411258 (PPARGC1A)
   04152 AMPK signaling pathway
    100411258 (PPARGC1A)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100411258 (PPARGC1A)
   04922 Glucagon signaling pathway
    100411258 (PPARGC1A)
   04920 Adipocytokine signaling pathway
    100411258 (PPARGC1A)
  09149 Aging
   04211 Longevity regulating pathway
    100411258 (PPARGC1A)
  09159 Environmental adaptation
   04714 Thermogenesis
    100411258 (PPARGC1A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    100411258 (PPARGC1A)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100411258 (PPARGC1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cjc03029]
    100411258 (PPARGC1A)
Mitochondrial biogenesis [BR:cjc03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    100411258 (PPARGC1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 Tox-ODYAM1
Motif
Other DBs
NCBI-GeneID: 100411258
NCBI-ProteinID: XP_002745991
Ensembl: ENSCJAG00000013024
UniProt: F7ISR8
Position
3
AA seq 798 aa AA seqDB search
MAWDMCNQDSESVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDSFLGGLKWCSD
QSEIISNQYNNEPSNIFEKIDEENEANLLAVLTETLDSLPVDEDGLPSFDALTDGDVTTD
NEASPSSMPDGTPPPQEAEEPSLLKKLLLAPANTQLSYNECSGLSTQNHANHNHRIRTNP
AIVKTENSWSNKAKSICQQQKPQRRPCSELLKYLTTNDDPPHTKPTENRNSSRDKCTSKK
KSHTQSQSQHLQAKPATLSLPLTPESPNDPKGSPFENKTIERTLSVELSGTAGLTPPTTP
PHKANQDNPFRASPKLKSSCKTVVPPPSKKPRYSESSGTQGNNSTKKGPEQSELYAQLSK
SSVLTGGHEERKTKRPSLRLFGDHDYCQSINSKTEILINISQELQDSRQLENKDVSSNWQ
GQICSSTDSDQCYLRETLEASKQVSPCSTRKQLQDQEIRAELNKHFGHPSQAVFDDEANK
TSELRDGDFSNEQFSKLPMFINSGLAMDGLFDDSEDESDKLSYPWDGTQSYSLFNVSPSC
SSFNSPCRDSVSPPKSLFSQRPQRMRSRSRSFSRHRSCSRSPYSRSRSRSPGSRSSSRSC
YYYESTHYRQRTHRNSPLYVTSRSRSPYSRRPRYDSYEEYQHERLKREEYRREYEKRESE
RAKQRERQRQKAIEERRVIYVGKIRPDTTRTELRDRFEVFGEIEECTVNLRDDGDSYGFI
TYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKY
DSLDFDSLLKEAQRSLRR
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atggcgtgggacatgtgcaaccaggactctgagtctgtatggagtgacatcgagtgtgct
gctctggttggtgaagaccagcctctttgcccagatcttcctgaacttgatctttctgaa
ctagatgtgaatgacttggatacagacagctttctgggtggactcaagtggtgcagtgac
caatcagaaataatatccaatcagtacaacaatgagccttcaaacatatttgagaagata
gatgaagagaatgaggcaaacttgctagcagtcctcacagagacactggacagtctccct
gtggatgaagacggattgccctcatttgatgcgctgacagatggagacgtgaccactgac
aatgaggctagtccttcctccatgcctgacggcacccctccgccccaggaggcagaagag
ccgtctctacttaagaagctcttactggcaccggccaacactcagctaagttataatgaa
tgcagtggtctcagtacccagaaccatgcaaatcacaatcacaggatcagaacaaaccct
gcaattgttaagactgagaattcatggagcaataaagcgaagagtatttgtcaacagcaa
aagccacaaagacgtccctgctcggagcttctcaaatatctgaccacaaacgatgaccct
cctcacaccaaacccacagagaacagaaacagcagcagagacaaatgcacctccaaaaag
aagtcccacacacaatcgcagtcgcaacatttacaagccaaaccagcaactttatctctt
cctctgacccccgagtcaccaaatgaccccaagggttccccatttgagaacaagactatt
gaacgcaccttaagtgtggaactctctggaactgcaggcctaactccacccaccactcct
cctcataaagccaaccaagataacccttttagggcttctccaaagctgaagtcctcttgc
aagactgtggtgccaccaccatcaaagaagccccggtacagtgagtcttctggtacccaa
ggcaataactccaccaagaaagggccggagcaatcggagttgtatgcacaactcagcaag
tcctcagtgctcactggcggacacgaggaaaggaagaccaagcggcccagtctacggctg
tttggtgaccatgactattgccagtcaattaattccaaaacggaaatactcattaatata
tcacaggagctccaagactctagacaactagaaaataaagatgtctcctccaattggcag
gggcagatttgttcttccacagattcagaccagtgctacctgagagagactttggaggca
agcaagcaggtctctccttgcagcacaagaaaacagctccaagaccaggaaatccgagct
gagctgaacaagcacttcggtcatcccagtcaagctgtttttgacgacgaagcaaacaag
accagtgaactgagggacggtgatttcagtaatgaacaattctccaaactacctatgttt
ataaattcaggactagccatggatggcctgtttgatgacagcgaagatgaaagtgataaa
ctgagctacccttgggatggcacgcaatcctattcattgttcaatgtgtctccttcttgt
tcttcttttaactctccatgtagagattccgtgtcaccacccaaatccttattttctcaa
agaccccaaaggatgcgctctcgttcaaggtccttttctcgacacaggtcgtgttcccga
tcaccatattccaggtcaagatcaaggtccccaggcagtagatcctcctcaagatcctgc
tattactatgagtcaactcactacagacagcgcacgcaccgaaattctcccttgtatgtg
acatcacgttcaagatcgccctacagccgtaggcccaggtatgacagctacgaggaatat
cagcacgagaggctgaagagggaagaataccgcagagagtatgagaagcgagagtctgag
agggccaagcaaagggagaggcagagacagaaggcaattgaagaacgccgtgtgatttat
gtcggtaaaatcagacctgacacaacacggacagaactgagggaccgctttgaagttttt
ggtgaaattgaggagtgcacagtaaatctgcgggatgatggagacagctatggtttcatt
acctaccgttatacctgtgatgcttttgctgctcttgaaaatggatacactttgcgcagg
tcgaacgaaactgacttcgagctgtacttttgtggacgcaagcaatttttcaagtctaac
tatgcagacctagattcaaactcagatgactttgaccctgcttccacgaagagcaagtat
gactctctggattttgatagtttattgaaagaagctcagagaagcttgcgcaggtaa

DBGET integrated database retrieval system