KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100411327Help
Entry
100411327         CDS       T03264                                 

Gene name
HBE1, HBG1
Definition
(RefSeq) hemoglobin subunit epsilon 1
  KO
K13825  hemoglobin subunit epsilon
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    100411327 (HBE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Globin DUF2884
Motif
Other DBs
NCBI-GeneID: 100411327
NCBI-ProteinID: XP_017833339
UniProt: P68026 B0VXB7
Position
11
AA seq 147 aa AA seqDB search
MVHFTAEEKAAITSLWGKMNVEEAGGEALGRLLVVYPWTQRFFDNFGNLSSPSAILGNPK
VKAHGKKVLTSFGDAIKNMDNLKTTFAKLSELHCDKLHVDPENFRLLGNVLVIILATHFG
KEFTPEVQAAWQKLVSAVAIALGHKYH
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggtgcattttactgctgaggagaaggctgccatcactagcctgtggggcaagatgaat
gtggaagaggctggaggtgaagccttgggcagactcctcgttgtatacccctggacccag
agatttttcgacaactttggaaacctgtcctctccctctgccatcctgggcaaccccaag
gtcaaggcccatggcaagaaggtgctgacttcctttggagatgctattaaaaacatggac
aacctcaagaccacctttgctaagctaagtgagctgcactgtgacaagctgcatgtggat
cctgagaacttcaggcttctgggtaacgtgttggtgattattctggctactcactttggc
aaggagttcactcctgaagtgcaggctgcctggcagaagctggtgtctgctgtggccatt
gccctgggccacaagtaccactga

DBGET integrated database retrieval system