KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100411407Help
Entry
100411407         CDS       T03264                                 

Gene name
CCL13
Definition
(RefSeq) C-C motif chemokine ligand 13
  KO
K16595  C-C motif chemokine 13
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04062  Chemokine signaling pathway
cjc04064  NF-kappa B signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100411407 (CCL13)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100411407 (CCL13)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100411407 (CCL13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100411407 (CCL13)
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100411407 (CCL13)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Chemokines
   100411407 (CCL13)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate/Haparin
  Chemokines
   100411407 (CCL13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 100411407
NCBI-ProteinID: XP_017828025
Position
5
AA seq 111 aa AA seqDB search
MKVSGAPLCLLLLTAAFSPQGLAQPDILKAFSFVTLFLSALNVPSVCCFKFSSKKISLQR
VKNYRITNRRCPQKAVNFRTKLGKEICADPKEKXVQNYMKRLGQKAHTLKS
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtctctggagcacctctgtgcctgctgctcctaacagcagccttcagtccccag
gggcttgctcagccagacatcctcaaagccttttcatttgtaactttatttctaagtgca
ctcaatgtcccatccgtctgctgcttcaagtttagcagtaagaagatctccttgcagagg
gtgaagaactataggatcaccaacaggcggtgtccccagaaggctgtcaacttcagaacc
aaacttggcaaggagatctgtgccgacccaaaggagaagtgagttcagaattatatgaaa
cgcctgggccagaaagctcacaccctgaagtcttga

DBGET integrated database retrieval system