KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100411457Help
Entry
100411457         CDS       T03264                                 

Gene name
PKMYT1
Definition
(RefSeq) protein kinase, membrane associated tyrosine/threonine 1
  KO
K06633  membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase [EC:2.7.11.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04110  Cell cycle
cjc04114  Oocyte meiosis
cjc04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100411457 (PKMYT1)
   04114 Oocyte meiosis
    100411457 (PKMYT1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100411457 (PKMYT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100411457 (PKMYT1)
   01009 Protein phosphatases and associated proteins [BR:cjc01009]
    100411457 (PKMYT1)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100411457 (PKMYT1)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: Other
  WEE family
   100411457 (PKMYT1)
Protein phosphatases and associated proteins [BR:cjc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100411457 (PKMYT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like
Motif
Other DBs
NCBI-GeneID: 100411457
NCBI-ProteinID: XP_002755863
Ensembl: ENSCJAG00000015415
UniProt: U3CWB5
Position
12
AA seq 499 aa AA seqDB search
MLERPPVLAMPVPTEGTPPPLSGTPVPVPAYFRHAEPGFSRKRPRGLSRSLPPPPPAKGS
IPISRLFPPRTPRWHQLRPRRVSFRGEASETLQSPGYDPSRPESFFQQSFQRLSRLGHGS
YGEVFKVRSKEDGQLYAVKRSMSPFRGPKDRARKLAEVGGHEKVGQHPRCVRLEQAWEEG
GILYLQTELCGPSLQQHCEAWGASLPEAQVWGYLRDTLLALAHLHGQGLVHLDVKPANIF
LGPRGRCKLGDFGLLVELGTAGAGEVQEGDPRYMAPELLQGSYGTAADVFSLGLTILEVA
CNMELPHGGEGWQQLRQGYLPPEFTAGLSSELRSVLVMMLEPDPKLRATAEALLALPVLR
QQRAWGALWYMTAEALSRGWALWQALLALLCWLWHGLAHPASWLQSPGPPATPPGSPPCS
LLLDSSLSSNWDDDSLGPSLSPEAVLARASGSTSTPRSRCMPRDALDLSDIDSEPPRGSF
PSFEPRNLLSLFEDTLDPT
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgctagaacggcctcctgtgctggccatgcccgtgcccacggagggcaccccgccgccc
ctgagtggcactcctgtcccagtcccagcttacttccgccacgcagaacctggcttctcc
cgcaagaggcccagggggctcagccggagcctcccacctccaccccctgccaagggcagc
atccccatcagccgcctcttccctcctcggaccccacgctggcaccagctgcgtccccgg
cgggtgtcattccgaggcgaagcctcagagaccctgcagagccctgggtatgacccaagc
cggccagagtccttcttccagcagagctttcagaggctcagccgcctgggccatggctcc
tacggagaggttttcaaggtgcgctccaaggaggatggtcagctctatgcagtaaagcgt
tccatgtcaccattccggggtcccaaggaccgggcccgcaagctggccgaggtgggcggc
catgagaaggtggggcagcacccacgctgcgtgcggctggagcaggcctgggaggaggga
ggcatcctgtacctgcagacggagctgtgtgggcccagcctgcagcagcactgtgaggcc
tggggcgccagcctgcccgaggcccaggtctggggctacctgcgggacacgctgcttgct
ctggcccacctgcatggccagggcctggtgcaccttgatgtgaagcctgccaacatcttc
ctggggcctcggggccgctgcaagctgggtgacttcggactgctagtggagctgggtaca
gcaggagctggcgaggttcaggagggagatccccgctacatggcccccgagctgctgcag
ggctcctatgggacagcagcggacgtgttcagtctgggcctcaccatcttggaagtagca
tgcaacatggagctgcctcatggtggggagggctggcagcagctgcgccagggctacctg
ccccccgagttcactgccggtctgtcttctgagctgcgttctgtccttgtcatgatgctg
gagccggaccccaagcttcgggccacagctgaggccctgctggcgctgcctgtgttgagg
cagcagagggcctggggtgcactgtggtatatgacagcggaggccctgagccgagggtgg
gccctgtggcaggccctgcttgccctgctgtgttggctctggcatgggctggctcaccct
gctagctggctgcagtccccgggcccgccggccaccccacctggctcaccaccctgtagc
ctgctcctggacagcagcctctccagcaactgggacgacgacagcctagggccctcactc
tcccctgaggctgtcctggcccgggcttcggggagcacttccaccccccggagcaggtgc
atgcccagggatgccctggacctaagtgacattgactcagagcctcctcgggggtccttc
ccctcctttgagcctcggaatctcctcagcctgtttgaggacaccctagacccaacctga

DBGET integrated database retrieval system