KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100411678Help
Entry
100411678         CDS       T03264                                 

Gene name
HIF1A
Definition
(RefSeq) hypoxia inducible factor 1 alpha subunit
  KO
K08268  hypoxia-inducible factor 1 alpha
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04066  HIF-1 signaling pathway
cjc04137  Mitophagy - animal
cjc04140  Autophagy - animal
cjc04659  Th17 cell differentiation
cjc04919  Thyroid hormone signaling pathway
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05211  Renal cell carcinoma
cjc05230  Central carbon metabolism in cancer
cjc05231  Choline metabolism in cancer
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100411678 (HIF1A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100411678 (HIF1A)
   04137 Mitophagy - animal
    100411678 (HIF1A)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100411678 (HIF1A)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100411678 (HIF1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100411678 (HIF1A)
   05205 Proteoglycans in cancer
    100411678 (HIF1A)
   05230 Central carbon metabolism in cancer
    100411678 (HIF1A)
   05231 Choline metabolism in cancer
    100411678 (HIF1A)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100411678 (HIF1A)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100411678 (HIF1A)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100411678 (HIF1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100411678 (HIF1A)
Transcription factors [BR:cjc03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    100411678 (HIF1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAS_3 PAS_11 HIF-1 PAS PAS_9 PAS_4 DDRGK HLH
Motif
Other DBs
NCBI-GeneID: 100411678
NCBI-ProteinID: XP_009004380
Ensembl: ENSCJAG00000019202
Position
10
AA seq 781 aa AA seqDB search
MEGASGANDKKNRISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDKASV
MRLTISYLRVRKLLDAGDLDIEDEMKAQMNCFYLKALDGFVMVLTDDGDMIYISDNVNKY
MGLTQFELTGHSVFDFTHPCDHEEMREMLTHRNGPVKKGKEQNTQRSFFLRMKCTLTSRG
RTMNIKSATWKVLHCTGHIHVYDTNSNQPQCGYKKPPMTCLVLICEPIPHPSNIEIPLDS
KTFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDMFTKGQ
VTTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSGIIQHDLIFSLQQTEC
VLKPVESSDMKMTQLFTKVESEDTSSLFDKLKKEPDALTLLAPAAGDTIISLDFGSNDTE
TDDQQLEEVPLYNDVMLPSSNEKLQNINLSMSPLATSETPKPLRSSADPALNQEVALKLE
PNPESLELSFTMPQIQDQPPSPSDGSTRQSSPEPNSPSEYCFYVDSDMVNEFKLELVEKL
FAEDTEAKNPFSTQDTDLDLEMLAPYIPMDDDFQLRSFDQLSPLESSSASPESASPQSTV
TVFQQTQIQELTSNATTTTATTDELKTVTKDRMEDIKILIASPSPTHIHKETTSATSSPY
RDTQSRTASPNRAGKGVIEQTEKSHPRSPNVLSVALSQRATVPEEELNPKILALQNAQRK
RKIEHDGSLFQAVGIGTLLQQPDDHATTTSLSWKRVKGCKSSEQNGMEQKSNYFNTLRFS
M
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atggagggcgccagcggcgcgaacgacaagaaaaataggataagttctgaacgtcgaaaa
gaaaagtctcgagatgcagccagatctcggcgaagtaaagaatctgaagttttttatgag
cttgctcatcagttgccacttccacataatgtgagctcacatcttgataaggcttctgtt
atgagacttaccatcagctatttgcgtgtgaggaaacttctggatgctggtgatttggat
attgaagatgaaatgaaagcacaaatgaattgcttttatttgaaagccttggatggtttt
gttatggttctcacagatgatggtgacatgatttacatttctgataatgtgaacaaatac
atgggattaactcagtttgaactcactggacacagtgtgtttgattttactcatccatgt
gaccatgaggaaatgagagaaatgcttacacacagaaatggccctgtgaaaaagggtaaa
gaacaaaacacacagcgaagcttttttctcagaatgaagtgtaccttaactagccgaggg
agaactatgaacataaagtctgcaacatggaaggtattacactgcacaggccatattcat
gtatatgataccaacagtaaccaacctcagtgtgggtataagaaaccacctatgacctgt
ttggtgctgatttgcgaacccattcctcacccatcaaatattgaaattcctttagatagc
aagacttttctcagtcgacacagcctggatatgaaattttcttactgtgatgaaagaatt
accgaattgatgggatatgagccagaagaacttttaggccgctcaatttacgaatattat
catgctttagactctgatcatctgaccaaaacgcatcatgatatgtttactaaaggacaa
gtcaccacaggacagtacaggatgcttgccaaaagaggtggatatgtctgggttgaaact
caagcaactgtcatatataacaccaagaactctcaaccacagtgcattgtgtgtgtaaat
tatgttgtgagtggtattattcagcacgacttgattttctcccttcaacaaacagaatgt
gtccttaaaccggttgaatcttcagatatgaaaatgactcagctattcaccaaagttgaa
tcagaagatacaagtagcctctttgataaacttaagaaggaacctgatgctttaactttg
ctggccccagctgctggagacacaatcatatctttagattttggcagcaatgacacagaa
actgatgaccagcaacttgaggaagtaccattgtataatgatgtaatgctcccctcatcc
aatgaaaaattacagaacataaatttgtcaatgtctccattagccacctctgaaactcca
aagccacttcgaagtagtgctgaccctgcactgaatcaagaagttgcattaaaattagaa
ccaaatccagagtcactggaactttcttttaccatgccccagattcaagatcagccaccc
agtccttctgatggaagcactagacaaagttcacctgagcctaacagtcccagtgaatat
tgtttttatgtggacagtgatatggtcaatgaattcaagttggaattggtagaaaaactt
tttgctgaagacacagaagcgaagaacccattttctactcaggacaccgatttagacttg
gagatgttagctccctatatcccaatggatgatgactttcagttacgttccttcgatcag
ttgtcaccgttagaaagcagttctgcaagccctgaaagcgcaagccctcagagcacagtt
acagtattccagcagactcagatacaagaacttacttctaatgccaccactaccactgcc
accactgatgaattaaaaacagtgacaaaagaccgtatggaagacattaaaatattgatt
gcatctccatctcctacccacatacataaagaaactactagtgccacatcatcaccatat
agagatactcaaagtcggacagcctcaccaaacagagcaggaaaaggagtcatagaacag
acagaaaagtctcatccaagaagccctaacgtgttatctgtcgctttgagtcaaagagct
acagttcctgaggaagaactaaatccaaagatactagctttgcagaatgctcagagaaag
cgaaaaattgaacatgatggttcactttttcaagcagtaggaattggaacattattacag
cagccagacgatcatgcaactactacatcactttcttggaaacgtgtaaaaggatgcaaa
tctagtgaacagaatggaatggagcaaaaaagcaattattttaataccctcagatttagc
atgtag

DBGET integrated database retrieval system