KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100411692Help
Entry
100411692         CDS       T03264                                 

Gene name
ABCC2
Definition
(RefSeq) ATP binding cassette subfamily C member 2
  KO
K05666  ATP-binding cassette, subfamily C (CFTR/MRP), member 2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01523  Antifolate resistance
cjc01524  Platinum drug resistance
cjc02010  ABC transporters
cjc04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    100411692 (ABCC2)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    100411692 (ABCC2)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100411692 (ABCC2)
   01523 Antifolate resistance
    100411692 (ABCC2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cjc02000]
    100411692 (ABCC2)
Transporters [BR:cjc02000]
 ABC Transporters, Eukaryotic Type
  ABCC (CFTR/MRP) subfamily
   ABCC1, 2, 3, 4, 5, 6, 10, 11, 12, 13 subgroups
    100411692 (ABCC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N MMR_HSR1 RsgA_GTPase AAA_16 AAA_29 Dynamin_N MeaB DUF87 FKBP_N_2
Motif
Other DBs
NCBI-GeneID: 100411692
NCBI-ProteinID: XP_002807504
Ensembl: ENSCJAG00000017142
Position
12
AA seq 1544 aa AA seqDB search
MLEKFCNSTFWNSSFLDSPEADLPLCFEQTVLVWIPLGFLWLLAPWQLLHVYKSRTKRSS
TTKLYLAKQVVVGFLLILAAIELALVFSEDSGQATVPAVRYTNPGLYLGTWLLVLLIQHS
RQWCVQKNSWFLSLFWILSILCGTFQFQTLIRTLLKGDNSNLAYSCLFFISYGFQILILI
FSAFSENNESSNNSSSTASFLSSITYSWYDSIVLKGYKQPLTLEDLWEVSEKIKTKTLVS
KFETHMKSELQKARRALQRRQQKHSQQNSGARLPGLNKNQSQSQDVLVLEEVKKKKKKSE
TKADVPKSWLIKALFKTFYMVLLKSFLLKLIHDIFVFVSPQLLKWLISFANDRDTYLWIG
YLCAILLFAVALIQSFCLQSYFQLCFKLGMAVRTTVMASVYKKALTLSNLARKKYTVGET
VNLMSVDAQKLMDVTNFIHQLWSSVLQIVLSIFFLWRELGPSVLAGVGVMVLVIPINGIL
STKSKAIQVKNMKNKDKRLRIMNEILSGIKILKYFAWEPSFRDQVHNLRKKELKNLLAFS
QIQCVVVFILHLTPVLVSVITFSVYVLVDSSNILDAQKAFTSITLFNILRFPLSTLPMMI
SSMLQASVSTERLEKYLGGDDLDTSAIRHDCNSDKAVQFSEATFTWERDMEATIRGVNLD
IMPGRLVAVMGTVGSGKSSLISAMLGEMENVHGHITIKGTTAYVPQQSWIQNGTIKDNIL
FGAELDEKRYQQVLEACALLPDLEILPGGDLAEIGEKGINLSGGQKQRISLARATYQNLD
IYLLDDPLSAVDAHVGKHIFNKVLGPNGLLKGKTRLLVTHSMHFLPHMDEIVVLGNGTIV
EKGSYSDLLAKKGEFAKNLKTFLKHTGPEDEATVHDGSEEEDDDYGLISSVEEIPEDAAS
IIIRRENSFHRTLSRSSRSSGRHPKSLKNSLKTRNVKSLKEDEELVKGQKLIKKEFVETG
KVKFSIYLRYLRAIGLFSIFFTLLMFVMNSVAFIGSNIWLSAWTSDSKTFNGTNYPASQR
DMRVGVYGALGLSQGICIFIAHFWSTYGFIHASNILHKQLLNNILRAPMRFFDTTPTGRI
VNRFAGDISTVDDTLPMSLRTWISCFLGIISTLVMICMXTPVFTSSSSSGIIYATVQMFY
VSTSRQLRRLDSVTRSPIYSHFSETVSGLPVIRAFAHQQRFLQHNEVKIDTNQKCVFSWI
TSNRWLAIRLELVGNLIVFFSALMMVIYRDTLNGDTVGFVLSNALNITQTLNWLVRMTSE
IETNIVAVERITEYTKVENEAPWVTDKRPPPDWPSKGNIQFSNYQVRYRPELDLVLKGIT
CDISSMEKIGVVGRTGAGKSSLTNCLFRILEAAGGQIIIDGVDIASIGLHDLREKLTIIP
QDPILFSGSLRMNLDPFNNYSDEEIWKALELAHLKSFVASLQLGLSHEVTEAGGNLSIGQ
RQLLCLGRALLRKSKILVLDEATAAVDLETDNLIQTTIQNEFAHCTVITIAHRLHTIMDS
DKIMVLDNGKIVEYGSPEELLQTPGPFYLMAKEAGIENVNSTEF
NT seq 4635 nt NT seq  +upstreamnt  +downstreamnt
atgctggagaagttctgcaactctaccttttggaattcctcattcctggacagtccggag
gcagacctgccactttgttttgagcaaactgttctggtgtggattcccttgggcttccta
tggctccttgccccctggcagcttctccatgtgtataaatccaggaccaagagatcttct
accaccaaactctaccttgctaagcaggtagtggttggttttcttcttattctagcagct
atagagctggcccttgtattctcagaagactctggacaagccacagtccctgctgttcga
tataccaacccaggcctctacctaggcacatggctcctggttttgctgatccaacacagc
agacaatggtgtgtacagaagaactcctggttcctgtccctattctggattctctccata
ctctgtggtactttccaatttcagactctaatccggacactcttaaagggtgacaattct
aatctggcctactcctgcctgttcttcatctcctacggattccagatcctgatcctgatc
ttttcagcattttcagaaaataatgagtcatcaaataactcatcatccacagcttcattc
ctgagtagcattacttacagttggtatgacagcatcgttctgaaaggctacaagcaacct
ctgacgctcgaagatctgtgggaagttagtgaaaagattaaaaccaagacactagtgagc
aagtttgaaacgcatatgaagagcgagctgcagaaagccaggcgggcactccagagacgg
cagcagaagcactcccagcaaaactctggagccaggctgcctggcttgaacaagaatcag
agtcaaagccaagatgtccttgtcctggaagaagttaaaaagaaaaaaaagaagtctgag
accaaagcagatgttccaaaatcctggttgatcaaagccttgttcaaaactttctacatg
gtgctcctgaaatcattcctgctgaagctaatccatgacatcttcgtatttgtgagtcct
cagctgctgaaatggctgatctcctttgcaaatgaccgtgacacatatttgtggattgga
tatctctgtgcaatcctcttatttgctgtggctcttattcagtcattctgccttcagagt
tatttccaattgtgcttcaagctgggtatggctgtacggacaactgtcatggcttctgtg
tataagaaggcattgaccctatccaacttggccaggaaaaagtacaccgttggagaaaca
gtgaacctgatgtctgtggatgctcagaagctcatggatgtgaccaacttcatccaccag
ctgtggtcaagtgttctacagattgtcttatccatcttcttcctatggagagagttggga
ccctcagtgttagcaggtgttggggtgatggtgctcgtaatcccaattaatgggatactg
tccaccaagagtaaggccattcaggtcaaaaatatgaagaataaagacaaacgtttaagg
atcatgaatgagattctcagtggaataaagatcctgaaatattttgcctgggaaccttca
ttcagagaccaagtccacaaccttcggaagaaagagcttaagaacctgctggcctttagt
caaatacagtgtgtggtggtattcatcttacacttaactccagtcctggtatctgtgatc
acattttcggtttatgtcctggtggatagcagcaatattttggatgcacaaaaggccttc
acctccattaccctcttcaatatcctgcgctttcccctgagcacgcttcccatgatgatc
tcctccatgctccaggccagtgtttccacagagcggctggagaagtacttgggtggggat
gacttggacacatctgccattcgacatgactgcaattctgacaaagctgtgcagttttca
gaggccacctttacctgggagcgtgatatggaagccacaatccgaggtgtgaacttggac
attatgccaggccgacttgtggctgtgatgggcactgtcggctctgggaaatcctccttg
atatcagccatgctgggagaaatggaaaatgtccacgggcacatcaccatcaagggcacc
actgcctatgtcccacagcagtcctggattcagaacggcaccataaaggacaacatcctt
tttggagcagagttggatgaaaagaggtaccagcaggtactggaggcctgtgctctcctc
ccagacttggaaatactgcctggaggagatttggctgagattggagagaagggtataaat
ctcagtgggggtcagaagcagcggatcagcctggccagagctacctaccaaaatttagac
atctatcttctagatgaccccctgtctgctgtggatgcccatgtaggaaagcatattttt
aataaggtcttgggccccaatggcctgttgaaaggcaagactcgactcttggttacacat
agtatgcactttcttcctcacatggatgagattgtggtcctggggaatggcacaattgta
gagaaaggatcctatagtgatctcttggccaaaaaaggagagtttgctaagaatctgaag
acatttctaaaacatacaggccctgaagacgaagccacagttcatgatggcagtgaagaa
gaagacgatgactacgggctgatatccagtgtggaagagatccctgaagatgcagcctcc
ataatcataagaagagagaacagctttcatcgaacgcttagccggagttctaggtccagt
ggaaggcatccgaagtccctgaaaaactccttgaaaactaggaatgtgaagagcctgaag
gaagatgaagaactagtgaaaggacaaaaactaattaagaaggaattcgtggaaactgga
aaggtgaagttttccatctacttgaggtacctacgagcaataggattgttttcgatattc
ttcaccctccttatgtttgtgatgaattctgtggcttttattggatccaatatctggctc
agtgcttggaccagtgactctaaaaccttcaatggcaccaactatccagcatctcagagg
gacatgagagttggagtctacggagctctgggattaagccaaggtatatgtattttcata
gcacatttctggagtacctatggttttatccatgcatcaaatatcttgcacaagcaactg
ctgaacaatatccttcgagcacccatgagattttttgatacaacacccacaggccggatt
gtgaacaggtttgccggcgatatttccacggtggatgacaccctgcctatgtccttgcgc
acctggatttcatgctttctgggaataatcagcacccttgtcatgatttgcatgnccacc
cctgtcttcacatcatcatcatcctctggcattatttatgcaactgttcagatgttttat
gtgtctacctcccgccagctgaggcgtctggactctgtcactaggtccccaatctactct
cacttcagcgagactgtgtcaggtttgccagttatccgtgcctttgcgcaccagcagcga
tttctgcaacacaatgaggtgaagattgacaccaaccagaaatgtgtcttttcctggatc
acctccaacaggtggcttgcaattcgcctggagctggttgggaacctgattgtcttcttt
tcggccttgatgatggttatttatagagatacactaaatggggacactgttggctttgtt
ctgtccaatgcactcaatatcacacaaaccctgaactggctagtgaggatgacatcagaa
atagagaccaacattgtggctgttgagcgaataactgagtacacaaaagtggaaaatgag
gcaccctgggtgactgataagaggcctccaccagattggcccagcaaaggcaacatccag
tttagcaactaccaagtgcggtaccgacctgagctggatctggtcctcaaagggatcact
tgtgacatcagtagcatggagaagattggtgtggtgggcaggacaggagctggaaagtca
tccctcacaaactgcctcttcagaatcttagaggctgctggtggtcagatcatcattgat
ggagtagatattgcttccattgggctccacgaccttcgagagaagctgaccattatcccc
caggaccccatcctgttctctggaagcctgaggatgaatcttgaccctttcaacaactac
tcagatgaagagatttggaaggccctggagctggctcacctcaagtctttcgtggccagc
ctgcaacttggcttatcccacgaagtaacggaggccggtggcaacctgagcataggccag
aggcagctgctgtgcctgggcagggctctgcttcggaaatccaagatcctggtcctggat
gaggccactgctgcggtggatctagagacagataacctcattcagacaaccatccaaaat
gagtttgcccactgcacagtgatcaccattgcccacaggctgcacaccatcatggacagc
gacaagataatggttctagacaatgggaagattgtagagtacggcagccctgaagaactg
ctgcaaaccccgggacccttttatttgatggctaaggaagctggcattgagaatgtgaac
agcacggaattttag

DBGET integrated database retrieval system