KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100411922Help
Entry
100411922         CDS       T03264                                 

Gene name
RAD51
Definition
(RefSeq) RAD51 recombinase
  KO
K04482  DNA repair protein RAD51
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03440  Homologous recombination
cjc03460  Fanconi anemia pathway
cjc05200  Pathways in cancer
cjc05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    100411922 (RAD51)
   03460 Fanconi anemia pathway
    100411922 (RAD51)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100411922 (RAD51)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100411922 (RAD51)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100411922 (RAD51)
   04121 Ubiquitin system [BR:cjc04121]
    100411922 (RAD51)
   03400 DNA repair and recombination proteins [BR:cjc03400]
    100411922 (RAD51)
Membrane trafficking [BR:cjc04131]
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    100411922 (RAD51)
Ubiquitin system [BR:cjc04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   BRCC complex
    100411922 (RAD51)
DNA repair and recombination proteins [BR:cjc03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA complex
     100411922 (RAD51)
    RecA family proteins
     100411922 (RAD51)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     100411922 (RAD51)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rad51 AAA_25 RecA HHH_5 ATPase ssDNA_TraI_N HHH
Motif
Other DBs
NCBI-GeneID: 100411922
NCBI-ProteinID: XP_017832411
Ensembl: ENSCJAG00000020821
Position
10
AA seq 339 aa AA seqDB search
MAMQMQLEANADTSVEEESFGPQPVSRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKEL
INIKGISEAKADKILVSIPNLVPMGFTTATEFHQRRSEIIQITXGCKELDNLLQGGIETG
SITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGL
SGSDVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSA
RQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRL
YLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgcagatgcagcttgaagcaaatgcagatacttcagtggaagaagaaagcttt
ggcccacaacctgtttcacggttagagcagtgtggcataaatgccaatgatgtgaaaaaa
ttggaagaagctggattccatactgtggaggctgttgcctatgcaccaaagaaggagcta
ataaatattaagggaattagtgaagccaaagctgataaaattctggtaagtattccaaat
ttggttccaatgggtttcaccactgcaactgaattccaccaaaggcggtcagagatcata
cagattacanttggctgtaaagagcttgacaatctacttcaaggtggaattgagactggc
tctatcacagaaatgtttggagaattccgaactgggaagacccagatctgtcatacactg
gctgtcacctgccagcttcccattgaccggggcggaggtgaaggaaaggccatgtacatt
gacaccgagggtacctttaggccagaacggctgctagcagtggctgagaggtatggtctg
tctggcagtgatgtcctggataatgtagcatatgctcgagcattcaacacagaccaccag
acccagctcctttatcaagcatcagccatgatggtagaatctaggtatgcactgcttatt
gtagacagtgccaccgccctttacagaacagactactcgggtcgaggtgagctttcagcc
aggcagatgcacttggccaggtttctgcggatgcttctgcgacttgctgatgagtttggt
gtagcagtggtaatcactaatcaggtggtagcccaggtggatggagcagccatgtttgcg
gccgatcccaaaaaacctattggaggaaacatcatcgcccatgcatcaacaaccagattg
tatctgaggaaaggaagaggggaaaccagaatctgcaaaatctacgactctccctgtctt
cctgaagctgaagctatgtttgccatcaatgcagatggagtgggagatgccaaagactga

DBGET integrated database retrieval system