KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100411976Help
Entry
100411976         CDS       T03264                                 

Gene name
ALDH5A1
Definition
(RefSeq) aldehyde dehydrogenase 5 family member A1
  KO
K00139  succinate-semialdehyde dehydrogenase [EC:1.2.1.24]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00250  Alanine, aspartate and glutamate metabolism
cjc00650  Butanoate metabolism
cjc01100  Metabolic pathways
Module
cjc_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    100411976 (ALDH5A1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100411976 (ALDH5A1)
Enzymes [BR:cjc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     100411976 (ALDH5A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 100411976
NCBI-ProteinID: XP_003732626
Ensembl: ENSCJAG00000006063
Position
4
AA seq 535 aa AA seqDB search
MATCFWLRSSGARRLGWTFPGCCLRPRSGGPAAASGPAPGPAQLRGXAGGLAGLSAALLH
TNSFVGGHWLPDAKTIPVKDPDNGASLGMMNDCGVPEEHAAVRAAYEAFCSWKRVRARER
SSLLRKWYDLMIKNKDDLAKIITAESGKPLKEAQGEILYSALFLEWFSEEARRVYGDIIY
TSARDKRSLVLKQPVGVAAVITPWNFPSAMITRKVGAALAAGCTVVVKPAEDTPFSALAL
AELANQAGIPPGVYNVIPCSRKNAKEVGEVICTDPLVSKISFTGSTTTGKVLLHHAANSV
KRVSMELGGLAPFIVFDSANVDQAVAGAMASKFRNTGQTCVCSNRFLVQRGIHDAFVKAF
AEAMKKNLRVGNGFEEGTTQGPLINEKAVEKVEKQVNDAVCKGATIVTGGKRHQLGKNFF
EPTLLSNVTQDMLCSHEETFGPLAPVIKFDTEEEAIAIANAADVGLAGYFYSQDPAQIWR
VAEQLEVGMVGVNEGLISSVECPFGGVKQSGLGREGSKYGIDEYLELKYVCYGGL
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggcgacctgcttctggctgcggagctccggggcccggcgcctcggttggacgtttccc
ggctgttgcctccgcccccgctccggcggaccggcggctgcctcgggtccagcgcccggc
ccggcccagctccgcggctaagctgggggcctggcgggcctctccgccgcgctgctgcac
accaacagcttcgtgggcggccactggctcccggacgccaaaaccatcccggtgaaagac
ccagacaacggcgcctccctgggcatgatgaacgactgcggggtgcccgaggaacacgct
gctgtgcgcgccgcctacgaagctttctgcagctggaagagggtgagagcacgtgagagg
agttcattacttcggaagtggtacgatttaatgataaaaaataaggacgatcttgccaaa
atcatcacagctgaaagtggaaagccactgaaggaggcgcagggagaaatcctctattcc
gcccttttcctggagtggttctcagaggaagcacgccgtgtttacggggacattatctac
acctcggcaagggacaagcggtccctggtcctcaagcagcccgtaggtgtggctgcagtc
atcaccccgtggaatttccccagtgccatgatcacccggaaggtgggggctgccctggca
gctggctgcaccgtggtggtgaagcccgccgaagacacgcccttctccgcgctggccctg
gctgagcttgcaaaccaggctggaattcctcccggcgtctacaatgtcattccctgctct
cgaaaaaatgccaaggaagtaggggaggtgatttgtactgatcctctggtgtccaaaatt
tcctttactggttcaacaaccacaggaaaggtcctgttgcaccatgcagcaaactctgtg
aaaagggtgtccatggagctgggtggcctcgctccatttatagtatttgacagtgccaac
gtggaccaggccgtggcaggggcaatggcatctaaatttaggaacactggacagacttgt
gtttgctcaaaccgattcttggtgcaaaggggcatccatgatgcctttgtaaaggcattt
gccgaggccatgaagaagaacctgcgtgtaggtaatggattcgaggagggaactacccag
ggcccgttaattaatgaaaaagcggtggaaaaggtggagaaacaggtgaatgatgctgtt
tgtaaaggggccaccatcgtgacaggcggaaaacgacaccaacttggaaaaaacttcttt
gagcccaccctgctcagcaatgtcacccaggacatgctgtgctctcacgaagagactttt
gggcctctggcacccgttatcaaattcgatacagaggaggaggctattgcaatcgccaac
gcagctgatgttgggttagcaggctatttttactctcaggacccagcccagatctggaga
gtggcagagcagctggaagtgggcatggttggcgtcaacgagggactgatttcctccgtg
gagtgccctttcggtggagtgaagcagtctgggcttgggcgagaggggtctaagtacggt
atcgatgagtacctggaactcaagtatgtgtgttacgggggcttgtag

DBGET integrated database retrieval system