KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100412016Help
Entry
100412016         CDS       T03264                                 

Gene name
IL2RA, CD25
Definition
(RefSeq) interleukin 2 receptor subunit alpha
  KO
K05068  interleukin 2 receptor alpha
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04144  Endocytosis
cjc04151  PI3K-Akt signaling pathway
cjc04630  Jak-STAT signaling pathway
cjc04640  Hematopoietic cell lineage
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc05162  Measles
cjc05166  Human T-cell leukemia virus 1 infection
cjc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    100412016 (IL2RA)
   04151 PI3K-Akt signaling pathway
    100412016 (IL2RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100412016 (IL2RA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100412016 (IL2RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100412016 (IL2RA)
   04658 Th1 and Th2 cell differentiation
    100412016 (IL2RA)
   04659 Th17 cell differentiation
    100412016 (IL2RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100412016 (IL2RA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100412016 (IL2RA)
   05162 Measles
    100412016 (IL2RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:cjc04050]
    100412016 (IL2RA)
   04090 CD molecules [BR:cjc04090]
    100412016 (IL2RA)
Cytokine receptors [BR:cjc04050]
 Interleukin receptor families
  IL2 receptor family
   100412016 (IL2RA)
CD molecules [BR:cjc04090]
 Proteins
  100412016 (IL2RA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sushi Stevor
Motif
Other DBs
NCBI-GeneID: 100412016
NCBI-ProteinID: NP_001244147
Ensembl: ENSCJAG00000020562
UniProt: Q19LH5
Position
7
AA seq 272 aa AA seqDB search
MDSQLLMWGLLTFIMVPCCQAELCDDDPPRITYATFKALAYKEGTMLNCECSRGFRRIKS
GSPYMLCTGSSSHSSWENQCQCIRSSPRNTTKQVTPQPEQQEERKPTEIPNPMQQVDQPS
LPGHCREPPQWENEGTERIYHFVVGQTVHYQCIQGYRALHRGPAESICKMTHGKTRWTQP
RLVCTKETEPSQFPGEEEPQASPDSLLESENSCLITTTDFQVQTEVAATMETFILTTKYQ
LAVACCVFLLISVLLLSGLTWQQRRRKSRRTI
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggattcacaactgctgatgtggggactgctcacgttcatcatggttccctgctgccag
gcagagctctgtgacgatgacccgccaaggatcacatacgccacgttcaaagcgttggcc
tacaaggagggaacgatgttgaactgtgaatgcagcagggggttccgtagaataaaaagc
gggtcaccctacatgctctgtacaggaagctctagccactcatcctgggagaaccagtgt
cagtgcatccgctcttcccctaggaatacaacaaaacaagtgacacctcaacctgaacag
caggaagagagaaaacccactgaaatcccaaatccgatgcagcaggtggaccaaccgagc
cttccaggtcactgcagggagcctccacagtgggaaaatgaaggcacagaaagaatttat
catttcgtggtagggcagacggttcactaccagtgcatccagggatacagggctctacac
agaggtcctgccgagagcatctgcaaaatgacccatggaaagacaaggtggacccagccc
cggctcgtgtgcacgaaggaaacggagcccagtcagtttccaggtgaagaggagcctcag
gcaagccctgacagccttcttgagagtgagaattcctgcctcatcacaacgacagatttt
caggtacagacagaagtggctgcgaccatggagacgttcatacttacgacgaagtaccag
ctagcagtggcctgctgtgttttcctgctgatcagcgtcctcctcctgagtgggctcacc
tggcagcagagacggagaaagagtagaagaacaatctag

DBGET integrated database retrieval system