KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100412154Help
Entry
100412154         CDS       T03264                                 

Gene name
DOCK7
Definition
(RefSeq) dedicator of cytokinesis 7
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100412154 (DOCK7)
Membrane trafficking [BR:cjc04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    100412154 (DOCK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N Elong_Iki1 TEA
Motif
Other DBs
NCBI-GeneID: 100412154
NCBI-ProteinID: XP_017830294
Ensembl: ENSCJAG00000016311
Position
7
AA seq 2155 aa AA seqDB search
MAERRAFAQKISRTVAAEVRKQISGQYSGSPQLLKNLNIVGNISHHTTVPLTEAVDPVDL
EDYLITHPLAVDSGPLRDLIEFPPDDIEVVYSPRDCRTLVSAVPEESEMDPHVRDCIRSY
TEDWAIVIRKYHKLGTGFNPNTLDKQKERQKGLPKQVFESDEAPDGNNYQDDQDDLKRRS
MSIDDTPRGSWACSIFDLKNSLPDALLPNLLDRTPNEEIDRQNDDQRKSNRHKELFALHP
SPDEEEPIERLSVPDVPKEHFGQRLLVKCLSLKFEIEIEPIFASLALYDVKEKKKISENF
YFDLNSEQMKGLLRPHVPPAAITTLARSAIFSITYPSQDVFLVIKLEKVLQQGDIGECAE
PYMIFKEADATKNKEKLEKLKSQADQFCQRLGKYRMPFAWTAIHLMNIVSSAGSLERDST
EVEISTGERKGSWSERRNSSIVGRRSLERTTSGDDACNLTSFRPATLTVTNFFKQEGDRL
SDEDLYKFLADMRRPSSVLRRLRPITAQLKIDISPAPENPHYCLTPELLQVKLYPDSRVR
PTREILEFPARDVYVPNTTYRNLLYIYPQSLNFANRQGSARNITVKVQFMYGEDPSNAMP
VIFGKSSCSEFSKEAYTAVVYHNRSPDFHEEIKVKLPATLTDHHHLLFTFYHVSCQQKQN
TPLETPVGYTWIPMLQNGRLKTGQFCLPVSLEKPPQAYSVLSPEVPLPGMKWVDNHKGVF
NVEVVAVSSVHTQDPYLDKFFALVNALDEHMFPVRIGDMRIMENNLENELKNSISALNTS
QLEPVVRFLHLLLDKLILLVVRPPVIAGQIVNLGQASFEAMASIINRLHKNLEGNHDQHG
RNSLLASYIYYVFRLPNTYPNSSSPGPGGLGGSVHYATMARSAVRPASLNLNRSRSLSNS
NPDISGTPTSPDDEVRSIIGSKGLDRSNSWVNTGGPKAAPWGSNPSPSAESTQAMDRSCN
RMSSHTETSSFLQTLTGRLPTKKGKEDELEKLSLLLFHEELALQWVVCSGSVRESALQQA
WFFFELMVKSMVHHLYFNDKLDAPRKSRFPERFMDDIAALVSTIASDIVSRFQKDTEMVE
RLNTSLAFFLNDLLSVMDRGFVFSLIKSCYKQVSSKLYSLPNPSVLVSLRLDFLRIICSH
EHYVTLNLPCSLLTPPASPSPSVSSATSQSSGFSTNVQDQKIANMFELSVPFRQQHYLAG
LVLTELAVILDPDAEGLFGLHKKVINMVHNLLSSHDSDPRYSDPQIKARVAMLYLPLIGI
IMETVPQLYDFTETHNQRGRPICIAPDDYESESGSMISQTVAMAIAGTSVPQLTRPGSFL
LTSTSGRQHTTFSAESSRSLLICLLWVLKNADETVLQKWFTDLSVLQLNRLLDLLYLCVS
CFEYKGKKVFERMNSLTFKKSKDMRAKLEEAILGSIGARQEMVRRSRGQLGTYTIASPSE
RSPSGSAFGSQENLRWRKDMTHWRQNTEKLDKSRAEIEHEALIDGNLATEANLIILDTLE
IVVQTVSVTESKESILGGVLKVLLHSMACNQSAVYLQHCFATQRALVSKFPELLFEEETE
QCADLCLRLLRHCSSSISTIRSHASASLYLLMRQNFEIGNNFARVKMQVTMSLSSLVGTS
QNFNEEFLRRSLKTILTYAEEDLELRETTFPDQVQDLVFNLHMILSDTVKMKEHQEDPEM
LIDLMYRIAKGYQTSPDLRLTWLQNMAGKHSERSNHAEAAQCLVHSAALVAEYLSMLEDR
KYLPVGCVTFQNISSNVLEESAVSDDVVSPDEEGICSGKYFTESGLVGLLEQAAASFSMA
GMYEAVNEVYKVLIPVHEANRDAKKLSTIHGKLQEAFSKIVHQSTGWEDGKRMFGTYFRV
GFYGTKFGDLDEQEFVYKEPAITKLAEISHRLEGFYGERFGEDVVEVIKDSNPVDKCKLD
PNKAYIQITYVEPYFDTYEMKDRITYFDKNYNLRRFMYCTPFTLDGRAHGELHEQFKRKT
ILTTSHAFPYIKTRVNVTHKEEIILTPIEVAIEDMQKKTQELAFATHQDPADPKMLQMVL
QGSVGTTVNQGPLEVAQVFLSEIPSDPKLFRHHNKLRLCFKDFTKRCEDALRKNKSLIGP
DQKEYQRELERNYHRLKEALQPLINRKIPQLYKALLPVTCHRDSFSRMSLRKMDL
NT seq 6468 nt NT seq  +upstreamnt  +downstreamnt
atggcggagcgccgcgccttcgcccagaaaatcagcagaacggtggcagctgaagttagg
aagcagatctccggtcaatatagtggttctccccaactgctcaaaaaccttaatattgtt
ggcaatatatcccatcataccaccgtgccccttactgaagcagtagatccagtggatttg
gaagattacctcattactcatcctttggctgtggattctgggcctttacgggatttgatt
gaatttcctccagatgatattgaagttgtttatagtcctcgtgactgcagaactcttgtt
tcagctgtacctgaagaaagtgaaatggatccacatgttagagactgtataagaagttat
acagaagactgggcaattgtcatcagaaaatatcataaattgggaacaggatttaatccc
aatacattagataaacagaaagaaaggcaaaaaggtttaccaaaacaggtctttgagtct
gatgaagctccagatggcaacaactaccaggatgaccaagatgatcttaaaagacgttca
atgtcaatagatgataccccaaggggtagctgggcctgtagtatctttgacttgaaaaat
tcacttcctgatgctttgcttcccaatttacttgatcgaactccaaatgaagaaatagac
cgtcagaatgatgaccaaaggaaatcaaaccgtcacaaagaactttttgctttgcatcca
tcaccagatgaggaagaaccaatagaacggcttagtgttcctgatgtacccaaagaacat
tttggtcaaagacttcttgtaaaatgcttatcgctgaagtttgaaattgaaattgaaccc
atttttgcaagtttagctttatatgatgtcaaggaaaagaaaaagatttcagaaaacttt
tattttgaccttaattctgagcaaatgaaaggattgttacgtccacatgtaccacctgct
gccattaccaccctggcaagatcagcaattttttctatcacttatccttcccaagatgtt
tttcttgtaataaagctagaaaaagttctacagcaaggagacattggagagtgtgcagaa
ccatatatgattttcaaagaagcagatgccaccaagaataaggaaaaactggagaaactg
aagagtcaagcagatcaattttgccaaagacttgggaaatatcgcatgccttttgcttgg
actgcaatccatttaatgaatattgttagcagtgctgggagtttggaaagagattctact
gaagtagaaatcagtactggagaacgaaaagggtcttggtcagagaggaggaattctagt
attgttggcagacgatcacttgaaaggacaacgagcggagatgatgcttgtaacttgaca
agttttcgaccagctactctcacagtgacaaatttttttaagcaggaaggagaccgctta
agtgatgaagatctctacaaattccttgctgatatgagaaggccgtcttctgtcttacgg
cgactaagacctattacagctcagctcaagatagacatttctcccgcacctgaaaatccc
cattattgcctgactccagagctgcttcaagtgaagctttaccctgacagtagagttaga
cctaccagagaaattttagagtttcctgcaagggatgtttatgttccaaacactacttac
agaaatcttctctacatataccctcagagtcttaattttgccaatcgtcaaggttctgct
agaaatataacagtgaaagtccagtttatgtatggagaggatccaagcaatgccatgccg
gtaatctttggtaaatctagctgttcagaattttcaaaggaagcctatacagccgtagta
tatcataacaggtctcctgattttcatgaagaaatcaaggttaagcttcctgctacttta
actgatcatcatcacttgctttttactttttatcatgttagttgtcaacaaaaacaaaat
actcctcttgaaacaccagttggatatacatggataccaatgcttcagaatggacggttg
aagactggccagttttgcttaccagtctcattggaaaaaccaccacaggcttattctgta
ctgtctcctgaggttcctctacctggcatgaaatgggtagataatcacaaaggtgttttt
aatgtggaagttgttgctgtttcatctgtccatacacaagatccttatcttgacaagttt
tttgctctggtcaatgctctggatgaacacatgttccccgtacgaattggggacatgcga
atcatggaaaataacttagaaaatgaattgaagaacagtatttcagcactgaatacatct
cagttggaaccagtggtccgatttcttcatcttctgctagataaattgatacttttagtt
gttagacctcctgtcattgctggccaaatagttaatctaggtcaagcatcttttgaagcc
atggcatcaattataaatcgacttcacaaaaacttggaaggaaatcatgaccagcatggc
agaaacagccttcttgcatcatatatttattatgttttccgcctaccaaatacttaccct
aattcatcttcaccaggtcctgggggtttgggaggatcagtgcattatgccacaatggct
agatctgctgtgagacctgcaagccttaatttaaatcgttctcgaagccttagtaatagc
aatccagatatatctgggactcccacatcaccagatgatgaagttcggtcaatcatcggg
agtaagggtttagatcgctccaattcctgggttaacactggtggtccaaaggctgcccca
tggggatccaaccccagtccaagtgcagaatcaacacaggctatggatcgaagttgtaat
cgtatgtcttcgcacacagagacgtcaagtttcttacaaacattaacgggacgcttacca
actaaaaagggaaaggaagatgagttagaaaaattgtcactcttactttttcatgaggag
ctggctttgcagtgggttgtttgcagtggcagcgttcgggaatcagctttgcaacaagcc
tggttcttttttgagttaatggtaaagagcatggtgcatcatttatactttaatgataaa
cttgatgctccaaggaaaagtcgttttccagaacgtttcatggatgacattgcagctctt
gtcagcacgattgctagtgatatagtttcgcgatttcagaaggacacagaaatggttgag
agactcaatacaagccttgcattctttctcaatgatctgttgtctgttatggacagagga
tttgtttttagccttataaagtcctgctataaacaggtgtcttcaaagctttactcatta
ccgaatccgagtgttctggtgtccttgaggctggattttctgcgaatcatctgcagtcat
gagcattatgttacattaaacttaccctgtagcttacttactccacctgcatctccatca
ccttctgtttcttctgcaacatctcagagttctggattttctacgaatgtacaagaccag
aagattgcaaatatgtttgaattgtcggtgcctttccgccaacagcattatttggcagga
cttgtgttaacagagttggctgtcattttagaccctgatgctgaaggactgtttggattg
cataagaaagtcatcaatatggtacacaatttactttccagtcacgactcagacccacgg
tactctgacccccagataaaggctcgagtggccatgttgtatctacctctgattggtatt
atcatggaaactgtacctcagctgtatgattttacagaaactcacaatcaacgtggaaga
ccaatttgtatagcccctgatgactatgaaagtgagagtggaagtatgataagccagact
gttgccatggcaatcgcggggacatcggtccctcaactaacaaggcctggcagtttcctc
ctcacatcaacgagtggcagacaacacactaccttttcagcagaatcaagtcgaagcctt
ttgatctgtctactttgggttctcaaaaatgcagatgaaacagttctacagaagtggttt
acagatctctcggtcttgcagctaaaccggctattagatctgctttatctctgtgtatct
tgctttgagtataaagggaaaaaagtgtttgaaagaatgaacagcttgacctttaagaaa
tcaaaagacatgagagcaaagcttgaagaagctattcttgggagcataggtgctaggcaa
gaaatggtgcgtcgaagccgaggacagcttggtacgtacacaatagcttctccttctgag
agaagcccatctggaagtgcgtttggaagtcaagaaaatttgaggtggagaaaagatatg
actcactggcgtcaaaacacagagaagcttgacaaatcaagagcagagattgaacatgaa
gcactgattgatggaaacctggctacagaagcaaacctaatcattttggatacattagag
attgttgttcagaccgtttctgtaacagaatccaaagagagcattcttggtggagtgcta
aaagtgctactacacagcatggcctgtaaccaaagtgcagtttatctacaacactgtttt
gctacacagagagccttggtttcaaagtttcctgaactcttatttgaagaagagacagag
cagtgcgctgatttatgcctcaggcttctccgacactgtagcagtagcatcagtacgata
cggtcacacgccagtgcttccctttacctactaatgaggcaaaactttgagattgggaat
aactttgccagggttaaaatgcaggtaacaatgtcattatcctccttggtgggcacatct
cagaattttaatgaagaattcttaagacgttctctaaagactatattgacgtatgctgaa
gaagatctggaattgagggaaacaacatttcctgatcaggttcaggatctggttttcaat
ctccatatgatcctttctgatactgtgaaaatgaaggaacaccaggaggatcctgaaatg
ttgattgacctaatgtacagaattgccaagggttaccagacctctccagatctgcgattg
acctggttgcagaacatggctggcaagcactcagaacgaagcaatcatgctgaagctgca
cagtgtctagtccattcagcagcacttgttgctgaatatttgagcatgctagaggaccgg
aaatatcttcctgtgggatgtgtaacatttcagaatatttcatctaatgttttagaagaa
tctgcagtctcagatgatgtggtatctccagatgaagaaggtatctgctctggaaaatac
tttactgagtcaggacttgtgggattactggaacaagcagctgcttctttctctatggct
ggcatgtatgaagccgttaatgaagtttacaaagtacttattcctgttcatgaagctaat
cgggatgcaaagaaactgtccacaattcatggtaaacttcaagaagcattcagcaaaatt
gttcatcagagtactggctgggaggatggtaagcggatgtttggcacctattttcgtgtt
ggtttttatggaaccaagttcggggatttggatgaacaagaatttgtttacaaggagcct
gcaataaccaaacttgcagagatatctcacagattggagggattttatggagaaagattt
ggagaggatgtggttgaagtaatcaaagactctaatcctgtagacaagtgtaaattagat
cctaacaaggcatatattcagattacctatgtggagccatactttgacacatatgagatg
aaggacagaatcacttacttcgacaaaaattataatcttcgccgcttcatgtactgtaca
ccctttactttagatggccgtgcccatggggaacttcatgaacaattcaaaaggaagacc
attctgactacatctcatgcctttccttatattaaaacaagggtcaatgtcactcacaaa
gaagagatcatcttaacaccaattgaagttgctattgaggacatgcagaaaaagacacag
gagttggcatttgcaacacatcaagatcccgcagaccccaaaatgcttcagatggtactc
cagggatctgtaggcacaacagttaatcaggggcctttggaagttgcccaggtttttctg
tctgaaatacctagtgacccaaagctcttcagacatcataataaactgcgactctgcttt
aaagattttactaaaaggtgtgaagatgccttaagaaaaaataagagcttaattgggcca
gatcaaaaggagtatcaaagagaactggagcgaaactatcatcgccttaaagaggcccta
cagccactgatcaacagaaagatccctcagttatacaaggcattattgcctgttacctgc
cacagagattccttcagtcgaatgagccttcgcaaaatggatctctaa

DBGET integrated database retrieval system