KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100412158Help
Entry
100412158         CDS       T03264                                 

Gene name
EGFR
Definition
(RefSeq) epidermal growth factor receptor
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01521  EGFR tyrosine kinase inhibitor resistance
cjc01522  Endocrine resistance
cjc04010  MAPK signaling pathway
cjc04012  ErbB signaling pathway
cjc04014  Ras signaling pathway
cjc04015  Rap1 signaling pathway
cjc04020  Calcium signaling pathway
cjc04066  HIF-1 signaling pathway
cjc04068  FoxO signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04144  Endocytosis
cjc04151  PI3K-Akt signaling pathway
cjc04510  Focal adhesion
cjc04520  Adherens junction
cjc04540  Gap junction
cjc04630  Jak-STAT signaling pathway
cjc04810  Regulation of actin cytoskeleton
cjc04912  GnRH signaling pathway
cjc04915  Estrogen signaling pathway
cjc04921  Oxytocin signaling pathway
cjc04926  Relaxin signaling pathway
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc04934  Cushing syndrome
cjc05160  Hepatitis C
cjc05163  Human cytomegalovirus infection
cjc05165  Human papillomavirus infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05206  MicroRNAs in cancer
cjc05210  Colorectal cancer
cjc05212  Pancreatic cancer
cjc05213  Endometrial cancer
cjc05214  Glioma
cjc05215  Prostate cancer
cjc05218  Melanoma
cjc05219  Bladder cancer
cjc05223  Non-small cell lung cancer
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
cjc05230  Central carbon metabolism in cancer
cjc05231  Choline metabolism in cancer
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100412158 (EGFR)
   04015 Rap1 signaling pathway
    100412158 (EGFR)
   04010 MAPK signaling pathway
    100412158 (EGFR)
   04012 ErbB signaling pathway
    100412158 (EGFR)
   04630 Jak-STAT signaling pathway
    100412158 (EGFR)
   04066 HIF-1 signaling pathway
    100412158 (EGFR)
   04068 FoxO signaling pathway
    100412158 (EGFR)
   04020 Calcium signaling pathway
    100412158 (EGFR)
   04072 Phospholipase D signaling pathway
    100412158 (EGFR)
   04151 PI3K-Akt signaling pathway
    100412158 (EGFR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100412158 (EGFR)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100412158 (EGFR)
   04520 Adherens junction
    100412158 (EGFR)
   04540 Gap junction
    100412158 (EGFR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100412158 (EGFR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100412158 (EGFR)
   04915 Estrogen signaling pathway
    100412158 (EGFR)
   04921 Oxytocin signaling pathway
    100412158 (EGFR)
   04926 Relaxin signaling pathway
    100412158 (EGFR)
   04928 Parathyroid hormone synthesis, secretion and action
    100412158 (EGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100412158 (EGFR)
   05206 MicroRNAs in cancer
    100412158 (EGFR)
   05205 Proteoglycans in cancer
    100412158 (EGFR)
   05230 Central carbon metabolism in cancer
    100412158 (EGFR)
   05231 Choline metabolism in cancer
    100412158 (EGFR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100412158 (EGFR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100412158 (EGFR)
   05212 Pancreatic cancer
    100412158 (EGFR)
   05225 Hepatocellular carcinoma
    100412158 (EGFR)
   05226 Gastric cancer
    100412158 (EGFR)
   05214 Glioma
    100412158 (EGFR)
   05218 Melanoma
    100412158 (EGFR)
   05219 Bladder cancer
    100412158 (EGFR)
   05215 Prostate cancer
    100412158 (EGFR)
   05213 Endometrial cancer
    100412158 (EGFR)
   05224 Breast cancer
    100412158 (EGFR)
   05223 Non-small cell lung cancer
    100412158 (EGFR)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100412158 (EGFR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100412158 (EGFR)
   05163 Human cytomegalovirus infection
    100412158 (EGFR)
   05165 Human papillomavirus infection
    100412158 (EGFR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100412158 (EGFR)
   01522 Endocrine resistance
    100412158 (EGFR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100412158 (EGFR)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100412158 (EGFR)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100412158 (EGFR)
Protein kinases [BR:cjc01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   100412158 (EGFR)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100412158 (EGFR)
  Exosomal proteins of pancreatic cancer cells
   100412158 (EGFR)
  Exosomal proteins of bladder cancer cells
   100412158 (EGFR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like Haspin_kinase GAPT Kdo
Motif
Other DBs
NCBI-GeneID: 100412158
NCBI-ProteinID: XP_017830696
Ensembl: ENSCJAG00000000989
UniProt: U3CZW4
Position
8
AA seq 1210 aa AA seqDB search
MRPSGTAGAALLALLAALCPASLALEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEV
VLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNMFYENSYALA
VLSNYDANKTGLKELPMRNLQEILHGAVRFSNNPTLCNVDSIQWRDIVSNDFLSNMSMDF
QNHVAGCQKCDPSCPNGSCWGAGEENCQKLTKIICAQQCSGRCRGKSPSDCCHNQCAAGC
TGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYV
VTDHGSCVRACGADSYEVEEDGVRKCKKCEGPCRKVCNGIGIGKFKDTLSINATNIKHFK
NCTSISGDLHILPVAFRGDSFTHTPPLDPKELDILKTVKEITGFLLIQAWPENRTDLHAF
ENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKHLCYANTINWKKL
FGTSSQKTKIINNRGENSCKATGHVCHSLCSSEGCWGPDPRDCVSCRNVSRGRECVEKCN
ILEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDSCIQCAHYIDGPHCVKTCPAGVM
GENNTLVWKYADAGHVCHLCHSNCTYGCIGPGPEGCAMDRPKIPSIATGIVAALLLVLVV
ALGIGLFMRRRRIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFKKIKVLGS
GAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGI
CLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAA
RNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSY
GVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPK
FRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDADEYLIPQ
QGFFSSPSTSRTPLLSSLSANSNNSTVACIDRNGLQTCPIKEDSFLQRYSSDPTRALTED
SIDDSFLPVPEYINQSVPKRPAGSVQNPVYHNQPLNLAPSRDPHYQDPHSTAVGNPEYLN
TVQPTWVSSAVDSPDHWIQKAIHQISLDNPDYQQDFLPKEAKPNGIFKGPTAENAEYLRV
APQSSEFIGA
NT seq 3633 nt NT seq  +upstreamnt  +downstreamnt
atgcgaccctcagggacggcaggggccgcgctcctggctctgctggctgcgctctgccca
gcgagtctggctctggaggaaaagaaagtttgccaaggcacgagtaacaagctcacgcag
ctgggcacttttgaagatcattttctcagcctccagaggatgttcaataactgtgaggtg
gtccttgggaatttggaaattacctacgtgcagaggaattatgatctttccttcttaaag
accatccaggaagtggccggttatgtcctcatcgccctcaacacagtggagcggattcct
ttggaaaacctgcagatcatcagaggaaatatgttctatgaaaattcctacgccttagca
gtcttatccaactatgatgcaaataaaaccggactgaaggagctgcccatgagaaactta
caggaaatcctgcatggcgccgtgcggttcagcaacaaccctaccctgtgcaacgtggac
agcatccagtggcgggacatcgtcagcaatgactttctaagcaacatgtcgatggacttc
cagaaccacgtggctggctgccaaaagtgtgatccaagctgtcccaatgggagctgctgg
ggtgcaggggaggagaactgccagaaactgaccaaaatcatctgtgcccagcagtgctct
gggcgctgccgcggcaagtcccccagtgactgctgccacaaccagtgtgccgcgggctgc
acgggccctcgagagagtgactgcctggtctgccgcaaatttcgagatgaagccacatgc
aaggacacctgccctccactcatgctctacaaccccaccacatatcagatggacgtgaac
cctgagggcaaatacagctttggtgccacctgtgtgaagaagtgtccccgtaactatgtg
gtgacagatcacggctcatgcgtccgagcctgtggggccgacagctacgaggtggaggaa
gacggcgtccgcaagtgtaagaagtgtgaaggaccttgccgcaaagtgtgtaacggaata
ggtattggtaaatttaaagacacactctccataaatgctactaatattaaacacttcaaa
aactgcacctccatcagcggtgatctccatatcctgccagtggcatttaggggtgactcc
ttcacacacactccacctctggatccaaaggaactggatattctgaaaactgtgaaggaa
atcacagggtttttgctgattcaggcttggcctgaaaacaggacggacctccatgctttt
gagaacctggaaatcatacgcggcaggaccaagcaacacggtcagttttctcttgcggtt
gtcagcctgaacataacatccctgggactacgctccctcaaagagataagcgatggagat
gtgataatttcaggaaacaaacatttgtgctatgcaaatacaataaactggaaaaaactg
tttgggacctccagccagaaaaccaagattataaacaacagaggtgaaaacagctgcaag
gccacaggccacgtctgccattccttgtgctcctccgagggctgctggggcccggacccc
agggactgcgtctcctgccggaacgtcagccgaggcagagagtgtgtggagaagtgcaac
attctggagggcgagccaagggagtttgtagagaactctgagtgcatccaatgccacccg
gaatgcctgccccaggccatgaacatcacctgcacgggacgggggccagacagctgcatc
cagtgtgcccactacatcgacggcccccactgtgtcaagacctgcccggcaggggtcatg
ggagaaaacaacaccctggtctggaagtacgcggacgccggccacgtatgccacctgtgc
cattcaaactgcacctacggatgcattgggccaggtcctgaaggctgtgcaatggatagg
cccaagatcccgtccatcgccactgggatcgtggctgccctcctcttggtgctggtggtg
gccctggggatcggcctcttcatgcgaaggcgccgcatcgtccggaagcgtacactgcgg
aggctgctgcaggagcgggagctcgtggagcctcttacgcccagcggagaagctcccaac
caagccctcttgaggatcttgaaggaaactgaattcaaaaagatcaaagtgctgggttct
ggtgcattcggcacggtgtataagggactctggatcccagaaggtgagaaagttaaaatt
cccgtagctatcaaggaattaagagaagcaacgtctccaaaagccaacaaggaaatcctt
gatgaagcctatgtgatggccagtgtggacaacccccatgtgtgccgcctgctgggcatc
tgcctcacctccacggtgcagctcatcacgcagctcatgccctttggctgcctcctggac
tacgtccgggagcacaaggacaacatcggctcccagtacctgctcaactggtgtgtgcag
atcgcaaagggcatgaactacctggaggaccggcgcttggtgcaccgcgacctggcagcc
aggaacgtgctggtgaagacgccgcagcatgtcaagatcacagattttgggctggccaaa
ctgctgggtgcagaagagaaagaatatcatgcggaaggaggcaaagtgcctatcaagtgg
atggcattggaatcaattttacaccgaatttatacccaccagagtgatgtctggagttac
ggggtgaccgtttgggagttgatgacctttggatccaagccatatgatggaatccctgcc
agcgagatctcctccatcctggagaaaggagaacgcctcccccagccacccatatgcacc
atcgatgtgtacatgatcatggtcaaatgctggatgatagacgcagacagtcgcccaaag
ttccgtgagttgatcattgaattctccaaaatggcccgagacccccaacgctaccttgtc
attcagggggatgaacgaatgcatttgccaagccctacagactccaacttctaccgcgcc
ctgatggatgaagaagacatggacgacgtggtggatgcggacgagtacctcatcccacag
cagggtttcttcagcagcccctccacgtcgcggactcccctcctcagctctctgagtgca
aacagcaacaattccaccgtggcttgcattgatagaaacgggctgcagacctgtcccatc
aaggaagacagcttcttacagcgatacagctcagaccccacaagagccttgactgaggac
agcatagatgactccttcctcccagtgcctgaatacataaaccagtctgttcccaaaagg
cctgctggctctgtgcagaatcctgtctaccacaatcagcccctgaacctcgcgcccagc
agagacccacactaccaggacccccacagcaccgcagtgggcaaccccgagtatctcaac
actgtgcagcccacctgggtcagcagcgcagtggacagccctgaccactggatccagaaa
gccatccaccaaatcagcctggataaccctgactaccagcaggacttccttcccaaggaa
gccaagcccaacggtatatttaagggccccacagctgaaaatgcagaatacctaagggtc
gcaccacaaagcagtgaatttattggagcatga

DBGET integrated database retrieval system