KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100412321Help
Entry
100412321         CDS       T03264                                 

Gene name
ATR
Definition
(RefSeq) ATR serine/threonine kinase
  KO
K06640  serine/threonine-protein kinase ATR [EC:2.7.11.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03460  Fanconi anemia pathway
cjc04110  Cell cycle
cjc04115  p53 signaling pathway
cjc04218  Cellular senescence
cjc05165  Human papillomavirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    100412321 (ATR)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100412321 (ATR)
   04115 p53 signaling pathway
    100412321 (ATR)
   04218 Cellular senescence
    100412321 (ATR)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100412321 (ATR)
   05170 Human immunodeficiency virus 1 infection
    100412321 (ATR)
   05165 Human papillomavirus infection
    100412321 (ATR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100412321 (ATR)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cjc03400]
    100412321 (ATR)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100412321 (ATR)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   100412321 (ATR)
DNA repair and recombination proteins [BR:cjc03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100412321 (ATR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase FAT UME FATC Mad3_BUB1_I TPR_1 THP2
Motif
Other DBs
NCBI-GeneID: 100412321
NCBI-ProteinID: XP_002759571
Ensembl: ENSCJAG00000001797
Position
17
AA seq 2647 aa AA seqDB search
MGEPGLELASMIPALRELGSATPEEYNTVVQKPRQILCQFIDRILTDVTVVAVELVKKTD
SQPTSVMLLDFIQHIMKSSPLMFVNVNGSHEAKGSCIEFSNWIITRLLRIAATPSCHLLH
KKICEVICSLLFLFKSKSPAIFGVLTKELLQLFEDLVYLHRRNVMGRAVEWPVVINRFLS
QLDEHMGYLQSSPLQLMSMQNLEFIEVTLLTVLTRIIAIVFFRRQELLLWQIGCVLLECG
SPKIKSLAISFLTELFQLGGLPAQLASTFFSSFLELLKHLVEMDTDQVKLYEEPLSKLIK
TLFPFEAEAYRNIEPVYLNMLLEKLCVMFEDGVLMQLKSDLLKAALCRLLQYFLTFVPAG
YESALQVRKVCVRNICKALLDILGIQVDAEYLLGPLYAALKMESMEIIEKIQCQTQQENL
SSNSDGLSPKRRRLSSSLNASKRAPKQTEAIKHVDMNKKSILWSALKQKAESLQISLEYS
GLKNHVIETLEGLAVVLQLTALCTVHCSHQNMNCHNFKDCRHKSKKKASVLITWMSLDFY
TKVLKSCRSLLESVQKPDLEATIDKVVKIYDALIYIQVNSSFEDHILEDLCGMLSLPWIY
SHSDDGCLKLTTFATSLLTLSRRISDSYSPQAQSRCAFLLTLFPRRIFLEWRTAVYNWAL
QSSHEVIRASCVRGFFILLQQQNSCNRIPKILIDKVKDDSDIVKKEFASILGQLVCTLDG
MFYLTSSLTEPFSGHGHVDLFCRNLKATSQHECSSSPLKASVCKAFLFLLKKKTPSPVKL
AFIDNLHHLCKHLDFREDETDVKAVLGTLLNLMEDPDKDVRVAFSGNIKHILESLDSEDG
FIKELFVLRMKEAYTHAQISRNNELKDTLILTTGDIGRAAKGDLVPFALLHLLHCLLSKS
ASVSGAAYTEIRALVAAKSVKLQNFFSQYKKPICQFLVESLHSSQMTALPSTSCQNADMR
KQDVAHQREMALNTLSEIANVFDFPDLNRFLTRTLQVLLPDLAAKASPAASALIRTLGKQ
LNVNRREILINNFKYIFSHLVCSCSKDELERALHYLKNETEIELGSLLRQDFQGLHNELL
LRIGEHYQQVFNGLSILASFASSDDPYQGPRDIISPELMADYLQPKLLGILAFFNMQLLS
SSVGIEDKKMALKSLMSLMNLMGPKHVSSVRVKMMTTLRTGLRFKDDFPELCCRAWDCFV
RCLDHACLGSLLSHVIVALLPLIHIQPKETTAIFHYLIIENRDAVQDFLHEIYFLPDHPE
LKRIKAVLQEYRKETSESTDLQTTLQLSMKAIQHENVDVRIHALTSLKETLYKNQEKLIK
YATDSETVEPVISQLVTVLLKGCQDANSQARLLCGECLGELGAIDPGRLDFSTTETQGKD
FTFVTGVEDLSFAYGLLMELTRAYLAYADNSRAQDSAAYAIQELLSIYDCREMETNGPGH
QLWRRFPEHVREILEPHLNTRYKSSQKSTDWSGVKKPIYLSKLGSNFAEWSATWAGYLIT
KVRHELASKIFTSCSIMMKHDFKVTIYLLPHILVYVLLGCNQEDQQEVYAEIMAVLKHDD
QQTVNTQDIASDLCQLSTQTVFSMLDHLTQWARHKFQTLKAEKCPHSKSNRNKVDSVVST
VDYEDYQSVTRFLDLIPQDALAVASFRSKAYTRAVMHFESFITEKKQNIQEHLGFLQKLY
AAMHEPDGVAGVSAIRKAEPSLKEQILEHESLGLLRDATACYDRAIQLEPDQIIHYHGVV
KSMLGLGQLSTVITQVNGVHANRSEWTDELNTYRVEAAWKLSQWDLVENYLAADGKSTTW
SVRLGQLLLSAKKRDITAFYDTLKLVRAEQIVPLSAASFERGSYQRGYEYIVRLHMLCEL
EHSINPLFQHSPGDSSQEDSLNWVARLEMTQNSYRAKEPILALRRTLLSLNKRPDYNEMV
GECWLQSARVARKAGHHQTAYNALLNAGESRLAELYVERAKWLWSKGDVHQALIVLQKGV
ELCFPENETPLEGKNMLIHGRAMLLVGRFMEETANFESNAIMKKYKDVTACLPEWEDGHF
YLAKYYDKLMPMVTDNKMEKQGDLIWYIVLHFGRSLQYGNQFIYQSMPRMLTLWLDYGTK
AYEWEKAGRSDRVQMRNDLGKINKVITEHTNCLAPYQFLTAFSQLISRICHSHDEVFVVL
MEIIAKVFLAYPQQAMWMMTAVSKSSYPMRVNRCKEILNKAIHMKKSLEKFVGDATRLTD
KLLELCNKPVDGNSSTLSMSTHFRMLKKLVEEATFSEILIPLQSVMIPTLPSILGTHANR
ASHEPFPGHWAYIAGFDDMVEILASLQKPKKISLKGSDGKFYIMMCKPKDDLRKDCRLME
FNSLINKCLRKDAESRRRELHIRTYAVIPLNDECGIIEWVNNTAGLRPILTKLYKEKGVY
MTGKELRQCMLPKSAALSEKLKVFQEFLLPRHPPIFHEWFLRTFPDPTSWYSSRSAYCRS
TAVMSMVGYILGLGDRHGENILFDSLTGECVHVDFNCLFNKGETFEVPEIVPFRLTHNMV
NGMGPMGTEGLFRRACEVTMRLMRDQREPLMSVLKXXXXXXXDPLVEWSKPVKGHSKASL
NETGEVVNEKAKTHVLDIEQRLQGVIKTRNRVTGLPLSIEGHVHYLIQEATDENLLCQMY
LGWTPYM
NT seq 7944 nt NT seq  +upstreamnt  +downstreamnt
atgggggaacctggcctggagctggcgtccatgatcccggctctgcgggagctgggcagt
gccacaccagaggaatataatacagttgtacagaagccaagacaaattctatgtcagttc
attgaccgaatacttacagatgtaactgttgttgctgtagaacttgtaaagaaaactgac
tctcagccaacctccgtgatgttgcttgatttcatccagcatatcatgaaatcctcccca
cttatgtttgtaaatgtgaatggaagccatgaggccaaaggcagctgtattgaatttagt
aattggatcataacaagacttctgcggattgcagcaactccctcctgtcatttgttacac
aagaaaatctgtgaagtcatctgttcattattatttctttttaaaagcaagagtcctgct
atttttggggtactcacaaaagaattgttacaactttttgaagacttggtttacctccat
agaagaaatgtgatgggtcgtgctgtggaatggcctgtggtcattaaccgatttttaagt
caattggatgaacacatgggatatttacagtcttctcctttgcagttgatgagtatgcaa
aatttagaatttattgaagtcactttattaacggttcttactcgtattattgcaattgtg
ttttttagaaggcaagaactcttactttggcagataggttgtgttctgctagagtgtggt
agtccaaaaattaagtccttagcaattagctttttaactgaactttttcagctgggagga
ctaccagcacaactagctagcacttttttcagctcatttttggaattattaaaacacctt
gtagaaatggatactgaccaagtgaaactctatgaagagccattatcaaagctgataaag
acactatttccctttgaagcagaagcttatagaaatattgaacctgtctatttaaatatg
ctgctggaaaaactctgtgtcatgtttgaagatggtgtgcttatgcagcttaagtctgat
ttgctcaaagccgctttatgccgtttactgcagtatttccttacatttgtgccagctggg
tatgaatctgctttacaagtcaggaaggtctgtgtgagaaatatttgtaaagctcttttg
gatatacttggaattcaggtagatgcagagtacttgttgggcccactttatgcagctttg
aaaatggaaagtatggaaatcattgagaagattcaatgccaaactcaacaagaaaacctc
agcagtaatagtgatggactatcacccaaaaggcgtcgtctcagctcgtctctcaacgct
tctaagagagcaccaaaacagactgaggcaattaaacatgtggatatgaacaaaaagagc
atattatggagtgcactgaaacagaaagctgaatcccttcagatttcccttgaatacagt
ggtctaaagaatcatgttattgaaacgttagaaggacttgctgttgtcttacaactgact
gctctgtgtactgttcattgttctcatcaaaacatgaactgccataatttcaaggactgt
cgacataaatccaagaagaaagcgtctgtattgataacttggatgtcattggatttttac
acaaaagtgcttaagagctgtagaagtttgttagaatctgttcagaaaccagacctggag
gcaaccattgataaggtggtgaaaatttatgatgctttgatttatatacaagtaaacagt
tcatttgaagatcatattctggaagatttgtgtggaatgctctcacttccatggatttat
tcccattctgatgatggctgtttaaagttgaccacatttgccactagtcttctaacatta
agccggaggatttcagacagctattcaccacaggcacaatcacgatgtgcgtttcttttg
actctgtttccaagaagaatattccttgaatggagaacagcagtttacaactgggccctg
cagagctcccatgaagtaatccgggctagttgtgttcgtggattttttatcttattgcag
cagcagaattcttgtaacagaattcctaagattcttatagataaagtcaaagatgattct
gacattgtcaagaaagaatttgcttctatacttggtcagcttgtctgtactcttgatggc
atgttttatctgacaagttctttaacagaacctttctctggacatggacatgtggacctc
ttctgtaggaacttgaaagccacttctcaacatgaatgttcatcttctccactaaaagct
tctgtttgcaaggctttcctttttctactgaaaaaaaaaacacctagtccagtgaaactt
gctttcatagataatctacatcatctttgtaagcatcttgattttagagaagatgaaaca
gatgtaaaagcagttcttggaactttattaaatttaatggaagatccagacaaagatgtt
agagtggcttttagtggaaatatcaagcatatattggaatccctggactctgaagatgga
tttataaaagagctttttgtcttaagaatgaaggaagcatatacacatgcccaaatatca
agaaataatgagttgaaggataccttaattcttacaacaggggatattggaagggctgca
aaaggagatttggtaccttttgcactcttgcacttactgcattgtttgttatccaagtca
gcatctgtctctggagcagcatacacagaaattagagctctggttgcagctaaaagtgtt
aaactgcaaaattttttcagccagtataagaaacccatctgtcagtttttggtagaatcc
cttcactctagtcaaatgacagcacttccgagtacttcctgccagaatgctgacatgcga
aaacaagatgtggctcaccagagagaaatggctttaaataccttgtctgaaattgccaac
gtttttgactttcctgatcttaatcgttttcttactaggacattacaagttctactacct
gatcttgctgccaaagcaagccctgcagcttctgctctcattcgaactttaggaaaacaa
ttaaatgtcaatcgtagagaaattttaataaacaacttcaaatatattttttctcatttg
gtctgttcttgttccaaagatgaattagaacgtgcccttcattatctgaagaatgaaaca
gaaattgaactggggagcctgttgagacaagatttccaaggattgcataatgaattattg
ctgcgtattggagaacactatcaacaggttttcaatggtttatcaatacttgcctcattt
gcatccagtgatgatccatatcagggcccaagagatattatatcacctgaactgatggct
gattatttacaacccaaattgttaggcattttggccttttttaacatgcagttactgagt
tccagtgttggcattgaagataagaaaatggccttgaaaagtttgatgtctttgatgaat
ttaatgggacccaaacatgtcagttctgtgagagtgaagatgatgaccacactgagaact
ggccttcgattcaaggatgattttcctgaattgtgttgcagagcttgggactgctttgtt
cgttgcctggatcatgcttgtctgggctcccttctcagtcatgtaatagtagctttgtta
ccacttatacacatccagcctaaagaaactacagctatctttcactacctcataattgaa
aacagggatgctgtgcaagattttcttcatgaaatatattttttacctgatcatccagaa
ttaaaaaggataaaagcagttctccaggaatacagaaaggagacctctgagagcactgat
cttcaaacaacccttcagctctctatgaaggccattcaacatgaaaatgtcgatgttcgt
attcatgctcttacgagcttgaaagaaaccttgtataaaaatcaggaaaaactgataaag
tatgcaacagacagtgaaacagtagaacctgttatctcacagttggtgacagtgcttttg
aaaggttgccaagatgcaaactctcaagctcggttgctctgtggggaatgtttaggggag
ttgggggcgatagatccaggtcgattagatttttctacaactgaaactcaaggaaaagat
tttacatttgtgactggagtagaagatttaagctttgcctatggattattgatggagcta
acaagagcttaccttgcatatgctgataatagccgagctcaagattcagctgcttatgcc
attcaggagttgctttctatttatgactgtagagagatggagaccaatggcccaggtcac
caattgtggaggagatttcctgagcatgttcgggaaatactagaacctcatctaaatacc
agatacaagagttctcagaagtcaaccgattggtctggagtaaagaaaccaatttactta
agtaaattgggtagtaattttgcagaatggtcagcaacttgggcaggttatcttataaca
aaggttcggcatgagcttgccagtaaaattttcacctcctgtagcattatgatgaagcac
gatttcaaagtgaccatctatcttcttccacatattctggtgtatgtcttattgggttgt
aatcaagaagatcagcaggaggtttatgccgaaattatggcagttctaaagcatgatgat
cagcaaaccgtaaatacccaagacattgcatctgatctgtgtcaactcagtacacagacc
gtgttctccatgcttgaccatctcacacagtgggcaaggcacaagtttcagacactgaaa
gctgagaaatgtccacacagcaaatcaaacagaaataaggtagactcagtggtatctact
gtggattatgaagactatcagagtgtaacccgttttctagacctcataccccaggatgct
ctggcagtagcttcctttcgctccaaagcatacacacgagctgtaatgcactttgaatca
tttattacagaaaagaagcaaaatattcaagaacatcttggatttttacagaaattatat
gctgctatgcatgaacctgatggagtggctggagtcagcgcaattagaaaggcagaacca
tctctaaaagaacagattcttgaacatgaaagccttggcttgctgagggatgccactgct
tgttatgacagggctattcagctagaaccagaccagatcattcattatcatggtgtagta
aagtccatgttaggtcttggtcagctgtctactgttatcactcaggtgaatggagtgcat
gctaacaggtctgaatggacagatgaattaaacacatacagagtggaagcagcttggaaa
ttgtcacagtgggatttggtggaaaactatttggcagcagatgggaaatctacaacatgg
agtgtcagactgggacagctattattatcagccaaaaaaagagatatcacagctttttat
gacacattgaaactagtgagagcagaacaaattgtacctctttcagctgcaagctttgaa
agaggctcttaccaacgaggatatgaatatattgtgagattgcacatgttgtgtgagttg
gaacatagcatcaacccacttttccagcactctccaggtgacagttctcaagaagattcc
ctaaactgggtagctcgactagaaatgacccagaattcctatagagccaaggagcctatc
ctggctctccggaggactttattaagcctcaataaaagaccagattacaatgaaatggtt
ggagaatgctggctacagagtgccagagtagctagaaaggctggtcaccaccagacagcc
tacaatgctctccttaatgcaggggaatcacgacttgctgaactgtatgtggaaagggca
aagtggctctggtccaagggtgatgtccaccaggcactaattgttcttcaaaaaggtgtt
gaattatgttttcctgaaaatgaaaccccacttgagggtaagaacatgttaatccatggt
cgagctatgctgctagtgggccgatttatggaagaaacagctaacttcgaaagcaatgca
attatgaaaaaatataaggatgtgactgcatgcctgccagaatgggaggatgggcatttc
taccttgccaagtactatgacaaattgatgcccatggtcacagacaacaaaatggaaaag
caaggtgatctcatttggtatatagttcttcattttggcagatctctacaatatggaaat
cagttcatatatcagtcaatgccacgaatgttaacactatggcttgattatggtacaaag
gcatatgaatgggaaaaagctggccgctctgatcgtgtacaaatgaggaatgatttgggt
aaaataaacaaggttattacagagcatacaaactgtttagctccgtatcaatttttgacg
gctttttcacaattgatctctcgaatttgtcattctcatgatgaagtttttgttgtcttg
atggaaataatagccaaagtatttctagcctatcctcaacaagcaatgtggatgatgaca
gctgtgtcaaagtcttcttatcccatgcgtgtgaacagatgcaaggaaatcctaaataaa
gccattcatatgaaaaagtccttagagaagtttgttggagatgcaactcgcctaacagat
aagcttctagaattgtgcaataaaccggttgatggaaatagttccacgttaagcatgagc
actcatttcagaatgcttaaaaagctggtagaagaagcaacatttagtgaaatcctcatt
cctctgcagtcagtcatgatacctacacttccgtcaattctgggaacccatgctaaccgt
gctagccatgagccatttcctggacattgggcctatattgcaggatttgatgatatggtg
gaaattctcgcttctcttcagaaaccaaagaaaatttctttaaaagggtcagatggaaag
ttctacatcatgatgtgtaagccaaaagacgacctgagaaaggattgtagactaatggaa
ttcaattccttgattaataagtgcttaagaaaagatgcagagtctcgtagaagagaactt
catattcgaacatatgcagttattccactgaatgacgaatgtgggattatcgaatgggtg
aacaacactgctggtttgagacctattctaaccaaactatataaggaaaagggagtgtat
atgacaggaaaagaacttcgccagtgtatgctaccaaagtcagcagctttatctgaaaaa
ctcaaagtattccaagaatttctcctgcccaggcatcctcctatttttcatgagtggttt
ctgagaacattccctgatcctacatcatggtatagtagcagatcagcgtactgccgttcc
actgcagtaatgtcaatggttggttacattctggggcttggagaccgtcatggtgaaaat
attctctttgattctttgactggtgaatgcgtacatgtggatttcaactgtcttttcaat
aagggagaaacctttgaagttccagaaattgtaccatttcgcctgactcataatatggta
aatggaatgggtcctatgggaacagagggtctttttcgaagagcatgtgaagttacaatg
aggctgatgcgcgatcagcgagagcctttaatgagtgttctaaaannnnnnnnnnnnnnn
nnnnnngatcctcttgtggagtggagtaaaccagtgaaaggacattccaaagcatcactg
aatgaaactggagaagttgtcaacgaaaaggccaagacccatgttcttgacattgagcag
cgactacaaggtgtaatcaagactcgaaatagagtgacaggactgccattatctattgaa
ggacatgtgcattaccttatacaagaagctactgatgaaaacttactatgccagatgtat
cttggttggaccccatatatgtga

DBGET integrated database retrieval system