KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100412411Help
Entry
100412411         CDS       T03264                                 

Gene name
SERPINB3, SERPINB4
Definition
(RefSeq) serpin family B member 3
  KO
K13963  serpin B
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09160 Human Diseases
  09174 Infectious diseases: Parasitic
   05146 Amoebiasis
    100412411 (SERPINB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Serpin FapA
Motif
Other DBs
NCBI-GeneID: 100412411
NCBI-ProteinID: XP_002757355
Ensembl: ENSCJAG00000006825
UniProt: B0CMA6
Position
13
AA seq 387 aa AA seqDB search
MNSLSEANTQFLFDLFQQFRKSKKNNIFYSPISITTALGMVLLGAKENTAQQINKVLHFD
QVTETEKAATYQVDKSGNVHQQFQKLLTELNKSTDAYELKIANKLFGEKMYQFLKEYLDA
IKKYYQTSVESVDFVEDPEESRKKINSWVESQTNEKIKNLFPDQSINRMTKLVLVNAIYF
KGQWETKFNKEDTKEEKFWPNKNTSKPVHMMRQYTFFHFALLEDVQAKVLEIPYKANDLS
MIVLLPNETDGLQKLEEKLTAEKLMKWTSLQNMRKVDVNLRLPRFKVEEAYDLKDTLRTM
GMVDVFSDADLSGMAGSRNLVISKVLHKAFVEVTEEGAEATAATGVTTGITSPPPTNEEF
HCNHPFLFFIRQNKTNSILFFGRFSSP
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaattccctcagtgaggccaacacccagttcttgttcgacctattccaacagttcaga
aaatcaaaaaagaacaacattttctattcccctatcagcatcacaacagcattagggatg
gtcctcttaggggccaaagaaaacactgcacaacaaattaacaaggttcttcactttgat
caagtcacagagacagagaaagctgccacataccaggttgataagtcaggaaatgttcac
cagcagtttcaaaagcttctgactgaattaaacaaatccactgatgcatatgagctgaag
atcgccaacaagctcttcggagaaaagatgtatcaatttttaaaggaatatttagatgcc
atcaagaaatattaccagaccagtgtggaatctgttgattttgtagaagatccagaagaa
agtcgaaagaagattaattcctgggtggaaagtcaaacgaatgaaaaaattaaaaaccta
tttcctgatcagagtattaacagaatgaccaaattggttcttgtgaatgcaatctatttc
aaagggcagtgggagacgaaatttaataaagaagacactaaagaggaaaaattttggcca
aacaagaatacatccaaacctgtacacatgatgaggcaatacacgttctttcattttgcc
ttgctggaggatgtacaggcaaaggtcctggaaataccgtacaaagccaacgatctaagc
atgattgtgctgctgccaaatgaaacggacggtctgcagaagcttgaagagaaactcact
gctgaaaaattgatgaaatggacaagtttgcagaatatgagaaaggtggatgtgaattta
cgcttacctcggttcaaagtggaagaggcctatgatctcaaggacacattgagaaccatg
ggaatggtggatgtcttcagtgatgcagacctctcaggcatggctgggagccggaatctc
gtgatatctaaagttctacacaaggcctttgtggaggtcactgaggagggagcggaggct
acagctgccaccggggtgacaacaggaatcacatcacctcctccaactaatgaagagttc
cattgtaatcaccctttcctattcttcatcaggcaaaataagaccaacagcatcctcttc
tttggcagattctcatccccttag

DBGET integrated database retrieval system