KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100412414
Entry
100412414         CDS       T03264                                 

Gene name
AFF3
Definition
(RefSeq) AF4/FMR2 family member 3
  KO
K15195  AF4/FMR2 family member 3
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cjc03021]
    100412414 (AFF3)
Transcription machinery [BR:cjc03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     100412414 (AFF3)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int
Other DBs
NCBI-GeneID: 100412414
NCBI-ProteinID: XP_008978387
Ensembl: ENSCJAG00000010071
UniProt: F7DY78
Position
14
AA seq 1251 aa
MDSFDLALLQEWDLESLWGEDILNQRNDSLVVEFQSSASRCRSVYEPDRNALRRKERERR
NQETQQDDGTFNSSYSLFSEPYKTNKGDELSNRIQNTLGNYDEMKDFLTDRSNQSHLVGV
PKPGVPQTPVNKIDEHFVADSRAQTQPSSICSTTTSTPAAVPVQQNKRGTMGWQKAGHPP
SDGQQRAAQQGSLRTLLGDGVGRQQPRAKQVCNVEVGLQTQERPPAMAAKHSNSGHCVQN
FPPSLASKPSLVQQKPTAYVRPMDGQDQAPDESPKLKSSSETSVHCTSYRGVPSSKPEPA
RAKAKLSKFSIPKQGEENRSGENNSCVEEIIREMTWLPPLSAIQAPGKGEPTKFPFPNKD
SQLVSSGHNNPKKGDAEPESPDNGTSNTSMLEDDLKLSSDEEENEQQAAQRTALRALSDS
VVVQQPNCRASVPSSKGSSSSSSSGSSSSSSDSESSSGSDSETESSSSESEGSKPPHFSS
PEAEPASSNKWQLDKWLNKVNPHKPPILIQNESHGPESNQYYNPVKEDVQDCGKLPDVCQ
PSLREKEIKSTCKEEQRPRTANKAPGSKGVKQKSPPAAVAVAVSAAAPPPAVPCAPTENA
TAPARRSAGKKPTRRTERTSAGDGANCHRPEEPAPADALGASVVVPPEPTKTRPCGNSRA
SHRKELRSSVTCEKRRTRGLSRIVPKSKEFIETESSSSSSSSDSDLESEQEEYPLSKAQA
VAASASSGNDQRLKEAAANGGTGPRAPVGSINARTTSDIAKELEEQFYTLVPFGRNELLS
PLKDSDEVRSLWVKIDLTLLSRIPEHLPQEPGVLSAPATKDSESVPPSHTSDTPAEKTLP
KSKRKRKCDVEDDYREIKKAQGEKESSSRLATSASNTLSANHCNMNINSVAIPINKNEKT
LRSPISPLSDASKHKYTSEDFTSSSRPNGNSFFTSASSSKKPKADSQLQPHGGDLTKAAH
NNSENIPLHKSRPQTEPWSPGSSGHRDCKRQKLIFDDMPRSADYFMQEAKRMKHKADAMV
EKFGKALNYAEAALSFIECGNAMEQGPMESKSPYTMYSETVELIRYAMRLKTHSGPSATP
EDKQLAALCYRCLALLYWRMFRLKRDHAVKYSKALIDYFKNSSKATQAPSPWGASGKSTG
TPSPMSPNPSPASSVGSQGSLSNTSSLSPSTIVSIPQRIHQMAANHVSITNSILHSYDYW
EMADNLAKENREFFNDLDLLMGPVTLHSSMEHLVQYSQQGLHWLRNSTHLS
NT seq 3756 nt   +upstreamnt  +downstreamnt
atggacagcttcgacttagctctgctccaggaatgggacctcgagtcgctgtggggtgaa
gacatcttaaaccagaggaatgactctctagttgtggaatttcagtcatcagccagcaga
tgcaggagtgtctatgaaccagatagaaatgcattacggaggaaagaaagagaaagaaga
aatcaagaaactcaacaagatgatggcacgtttaattctagttactctctcttcagtgag
ccctacaagactaacaagggggatgaactctctaatcggatccagaacactttaggcaat
tatgatgaaatgaaagactttttaactgatagatccaatcagagtcatctcgttggcgtt
cccaaacctggggttcctcagactcctgtgaacaagattgatgaacattttgttgcagac
tcaagagcccagacccagccctcatctatctgtagcactacaacttccacaccagcagct
gtccctgtgcagcagaataagagaggcaccatgggctggcagaaggctgggcatccgccc
tcagatggccaacagagagcagcacaacagggctctctcagaaccttgcttggagatggt
gttggcagacagcagccgcgggccaaacaagtgtgcaatgtggaggtgggccttcagacc
caggagaggccacctgccatggcagccaagcacagcaacagtggacactgtgttcagaac
tttcctccatccctagcttcaaaacccagcctggttcagcagaaaccgactgcatatgtg
cggccgatggacggccaagatcaggcccctgatgagtctcctaagctgaagtcatcttcg
gaaaccagcgtgcactgcacatcatacagaggagttccctccagcaagccggagccagcc
agagccaaggccaagctctccaagttcagcatccccaagcagggggaggagaatagatct
ggagaaaacaacagctgtgttgaagaaataatccgggagatgacctggcttccaccactt
tctgctattcaagcacctggcaaaggggaaccaaccaaatttccatttccaaataaggac
tctcagcttgtatcctctggacacaataatccaaagaaaggtgatgcagagccagagagt
ccagacaatggcacatcgaatacatcaatgctggaagatgaccttaagctaagcagtgat
gaagaggagaatgaacagcaggcagcccagagaacagctctccgcgctctgtctgacagc
gtcgtggtccagcagcccaactgcagagcctcagtgccttccagcaagggcagcagtagc
agcagcagcagcggcagcagcagctcctccagcgactcggagagcagctccggatccgac
tcggagaccgagagcagctccagcgagagtgagggcagcaagcccccccacttctccagc
cccgaggctgaaccagcatcttctaacaagtggcagctggataaatggctaaacaaagtt
aatccccacaagcctcctattctgatccaaaatgaaagccacgggccagagagcaatcag
tactacaacccagtgaaagaggatgtccaggactgtgggaaactccccgacgtttgccag
cccagcctgagggagaaggagatcaagagcacctgcaaggaggagcagaggccgaggaca
gcgaacaaggcccctgggagtaaaggcgtgaagcagaagtccccgcccgcggccgtagcc
gtggcggtgagcgcagccgccccgccgcccgcagtgccctgtgcgcccacggagaacgca
accgcgcccgcccggaggtcagcgggcaagaagcccaccaggcgcactgagaggacctcg
gccggggacggcgccaactgccaccggcccgaggagcccgcgcccgcggacgcgctgggg
gcgagcgtggtggtccccccagagcccaccaaaaccaggccctgcggcaacagcagagcg
agccaccgcaaggagctgcgctcctccgtgacctgtgagaagcgccgcacacggggcctg
agcaggatcgtccccaaatccaaggagtttattgagacagagtcgtcatcttcgtcctcc
tcctcggactccgacctggagtccgagcaggaggagtaccctctgtccaaagcacaggcc
gtggctgcctctgcctcctccgggaacgaccagaggctgaaggaggctgctgccaacggg
ggcactggtcccagggcccctgtaggctccatcaacgccaggaccaccagtgacatcgcc
aaggagctggaggagcagttctacacgctggtcccctttggccggaacgaacttctctcc
cctctaaaggacagtgatgaggtcaggtctctctgggtcaaaatcgacctgaccctcttg
tccaggatcccagaacacctgccccaggagccaggggtcttgagcgcccctgccaccaag
gactccgagagcgtaccacccagccacacctcggacactcctgcagaaaagactttgcca
aaatccaagagaaaacgcaagtgtgacgtcgaagacgactacagggagatcaagaaggcc
cagggagagaaagagagctcttcaagactggccacctccgccagtaatactttgtctgca
aaccactgcaacatgaacatcaacagcgtggcaataccaataaataaaaatgaaaaaacg
cttcggtcgcccatctcacccctctctgatgcatctaaacacaaatacaccagcgaggac
ttcacttcttccagccgacctaatggcaacagcttcttcacttcagcctcttccagcaaa
aagccgaaggccgacagccagctgcagcctcacggtggagacctcacgaaagcagctcac
aacaattccgaaaacattcccctccacaagtcacggccacagacagagccgtggtctcca
ggctccagcggccacagggactgcaagagacagaaacttatcttcgatgatatgcctcga
agtgcagattactttatgcaagaagctaaacgaatgaagcataaagcagatgcaatggtg
gaaaagtttggaaaggctttgaactatgctgaagcagccttgtcgtttattgagtgtgga
aatgcaatggaacaaggccccatggaatctaaatctccttatacgatgtattcagaaaca
gtagagctcatcaggtatgctatgagactaaaaacccactcaggcccgagtgccacacca
gaagacaaacaactggctgcattatgttaccgatgcctggctctcctgtactggaggatg
tttcgactcaaaagggaccatgctgtaaagtattcaaaagcacttatcgactatttcaag
aactcatctaaagccacccaagccccgtctccgtggggggccagtggaaagagcactgga
accccatcccccatgtctcccaacccctctcccgccagctccgtggggtctcagggcagc
ctctccaacaccagctccctgtccccgtcgaccatcgtcagcatcccacagcgcatccac
cagatggcggccaaccatgtcagcatcaccaacagcatcctgcacagctacgactactgg
gagatggccgacaacctggccaaggaaaaccgagaattcttcaacgacttggatctgctc
atggggccagtcaccctgcacagcagcatggagcacctggtccagtactcccaacagggc
ctgcactggctgcggaacagcacccacctgtcatag

DBGET integrated database retrieval system