KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100412515Help
Entry
100412515         CDS       T03264                                 

Gene name
GALC
Definition
(RefSeq) galactosylceramidase
  KO
K01202  galactosylceramidase [EC:3.2.1.46]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00600  Sphingolipid metabolism
cjc01100  Metabolic pathways
cjc04142  Lysosome
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    100412515 (GALC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    100412515 (GALC)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.46  galactosylceramidase
     100412515 (GALC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_59 Glyco_hydro_59M Patatin Glyco_hydro_30
Motif
Other DBs
NCBI-GeneID: 100412515
NCBI-ProteinID: XP_002807300
Ensembl: ENSCJAG00000017259
Position
10
AA seq 685 aa AA seqDB search
MAEMLLPASQQRRVKAMTAAADSAGRAAVPLLLCALLAPGGAYVLDDSDGLGREFDGIGG
VSGGGATSRLLVNYPEPYRSQILDFLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYA
LDENYFRGYEWWLMKEAKKRNPNITLIGLPWSFPGWLGKGFNWPYVNLQLTAYYVVTWIV
GAKRYHDLDIDYIGIWNERPYNVNYIKVLRKMLNYQGLQQVKIIASDSLWESISASMLLD
AELLKAIDVIGAHYPGTHTVKDAQLTGKKLWSSEDFSTLNSDTGAGCWGRILNQNYINGY
MTSTIAWNLVASYYEQLPYGRCGLMTAQEPWSGHYVVESPVWVSAHTTQFTQPGWYYLKT
VGHLEKGGSYVALTDGLGNLTIIIETMSHKHSKCIRPFLPYFNVSQQFATFILKGSFSKI
PELQVWYTKLGKSSERFLFKQLDSLWLLDSIGNFTLELQEDELFTLTTLTTGRKGSYPLP
PKSQPFPSTYKDDFDVDYPFFSEAPNFADQTGVFEYFTNSEDPGEHRFTLRQVLNQRPIT
WAADASNTITIIGDYDWTNLTIKCDVYIETPDTGGVFIAGRVNKGGVLIRSARGIFFWIF
ANGSYRVTGDLAGWIIYALGHVEVTAKKWYTLTLTIRGGFASGMLNDKSLWTDIPVNFPK
NGWAAIGTHSFEFAQFDNFYVEATS
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atggctgagatgctgctgccggcttcccagcaacgccgagtgaaagccatgaccgccgcc
gcggactcggcgggccgcgccgcggtgccgctgctgctgtgcgcgctgctggcgcccggc
ggcgcgtacgtgctcgacgattccgacgggctgggccgggaattcgacggtatcggcggg
gtcagcggcggcggggcaacctcccgacttctggttaattacccagagccctatcgttct
caaatattggattttctctttaagccgaattttggtgcctctttgcatattctaaaagtg
gaaataggtggtgacgggcagacaacagatggcactgagccctcccacatgcactatgca
ctagatgagaattatttccggggatatgaatggtggttaatgaaggaagctaagaagagg
aatcctaatattacactcattgggttgccatggtcattccctggatggctgggaaaaggt
ttcaactggccttatgtcaatcttcagctgactgcctattatgtcgtaacctggattgtg
ggtgccaagcgttatcatgacttggacattgattatattggaatttggaatgagaggcca
tataatgtcaattatattaaggtattaagaaaaatgttgaactatcaaggtctccagcaa
gtgaaaatcatagcaagtgatagtctctgggagtccatttcagcttccatgctgcttgat
gccgaactcttaaaggcgattgatgttataggggctcattatcctggaacccatacagta
aaagatgcacaattaactggaaagaagctttggtcttctgaagactttagcactttaaat
agtgacacgggtgcaggctgctggggtcgcattttaaatcagaattacatcaatggctat
atgacttccacaatcgcatggaatttagtggctagttactatgaacagttgccttacggg
agatgcgggttgatgacagctcaggagccatggagtgggcactacgtggtagaatctcct
gtctgggtgtcagctcataccactcagtttactcaacctggatggtattacctgaagaca
gttggccatttagagaaaggaggaagttacgtagctctaactgatggcttagggaacctc
accatcatcattgaaaccatgagtcataaacattctaagtgtatacggccatttcttcct
tatttcaatgtgtcacaacaatttgctacctttattctcaagggatcttttagtaaaata
ccagagctacaggtgtggtataccaaacttggaaaatcatctgaaagattcctttttaag
cagctggattctctatggctcctcgacagcattggcaatttcacactggaactgcaagaa
gatgagctgttcacactcaccactctcaccactggtcgcaaaggcagctacccactgcct
ccaaaatcccagcccttcccaagtacctataaggatgatttcgatgttgattacccattt
tttagtgaagctccaaactttgctgatcaaactggtgtatttgaatattttacaaatagt
gaagaccctggagagcatcgcttcacactacgccaagttctcaaccagagacccattacg
tgggctgctgatgcatccaacacaatcactattataggagactacgactggaccaatctg
actatcaagtgtgatgtttacatagagacccctgacacgggaggtgtgttcattgcagga
agagtaaataaaggtggtgttttgattagaagtgccagaggaattttcttctggattttt
gcaaatggatcttatagggttacaggtgatttagctggatggattatatatgctttagga
catgttgaagttacagcaaaaaaatggtatacactcacgttaactattaggggtggtttc
gcctctggcatgctgaatgacaagtctctgtggacagacatccctgtgaattttccaaag
aatggctgggccgcaattggaactcactcctttgaatttgcacagtttgacaacttttat
gtggaagccacaagctaa

DBGET integrated database retrieval system