KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100412639Help
Entry
100412639         CDS       T03264                                 

Gene name
IL4R
Definition
(RefSeq) interleukin 4 receptor
  KO
K05071  interleukin 4 receptor
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04151  PI3K-Akt signaling pathway
cjc04630  Jak-STAT signaling pathway
cjc04640  Hematopoietic cell lineage
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc05200  Pathways in cancer
cjc05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    100412639 (IL4R)
   04151 PI3K-Akt signaling pathway
    100412639 (IL4R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100412639 (IL4R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100412639 (IL4R)
   04658 Th1 and Th2 cell differentiation
    100412639 (IL4R)
   04659 Th17 cell differentiation
    100412639 (IL4R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100412639 (IL4R)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    100412639 (IL4R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:cjc04050]
    100412639 (IL4R)
   04090 CD molecules [BR:cjc04090]
    100412639 (IL4R)
Cytokine receptors [BR:cjc04050]
 Interleukin receptor families
  IL2 receptor family
   100412639 (IL4R)
CD molecules [BR:cjc04090]
 Proteins
  100412639 (IL4R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL4Ra_N fn3 LRRC37AB_C
Motif
Other DBs
NCBI-GeneID: 100412639
NCBI-ProteinID: NP_001244161
Ensembl: ENSCJAG00000005921
UniProt: Q0PIT7
Position
12
AA seq 824 aa AA seqDB search
MGWLCSGLLFPVSYLVLLQVAGSGSMKVLQEPTCVSDYISLSTCEWKMGGPTNCSAELRL
VYQLVFLISETNMCVPENNGAAGCVCHLFMEDMVGADNYTLDLWAGQQLLWKGSFKPSEH
VKPKAPENLTVYTNVSETLLLTWSNPYPPDNYLYEKLTYAVNIWNENDPTDSRIYDVTYQ
EPTLRIAASTLKSGVSYRARVRAWAQSYNSTWSEWSPSTKWYNAYKEPFEKHLLLGVSVS
CVVILAICMLCYVSIIKIKKEWWDQIPNPARSPLVAIVIQDPQVSQWEKRPRGQEPAKCP
HWKTCLTKLLPCFLEHSMKRDEDPLKAAKDRPFQGSEKSAWCPVEISKTVLWPESISVVR
CVELFEAPVECEEEEVEEDKGSFCALPESSRDGFQEGREAIVARLTESLFLDLLGGENGD
FCQQDMGESCLLPPSGSTSAHMPWDEFPSAGPKGVLPRGEEQPLHLERSPPGSPTRSPDN
PTCTETPLVIADNPAYRSFDNSLSRCPCPGELGPDPLLARHLEEVDPEMPCALQPSEPTN
VSPPEPETWEQILRRNVLQHGAAAAPASAPTSGYREFAHAVEQGGIPAGAMGGLGPPGEP
AYKAFSSLLASNAVSPGTYGFGASSGEEGYKPFQDLIPGCPEDPAPVPVPLFTFGLDREP
PRSPQSSHLPSSSPEQLGLEPGVKGEDMWKPPLLPEQAIDPLGDSLGSGIVYSALTCHLC
GHLKQCHGQEDGGQAPVVASPCCGCCCGDRSSPPTTPLRAPDPSPGEVPLEASLLPASPA
PSGNSEKSKSPLSFHPAPGSAQSSIQVPKIMNFVSGEPTFMRVS
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atggggtggctttgctctgggctcctgttccctgtgagctacctggttctgctgcaggtg
gcaggctctgggagcatgaaagtcctgcaggagcccacctgcgtctccgactacatcagc
ctctctacctgcgagtggaagatgggtggtcccaccaattgcagcgcagagctccgcctg
gtctaccagctggtttttctgatttccgaaaccaacatgtgtgtccctgagaacaacgga
gctgcggggtgcgtgtgccacctgttcatggaggacatggtcggagcagacaactacacg
ctggacctgtgggctgggcagcagctgctgtggaaaggctccttcaagcccagcgagcac
gtgaaacccaaggctccagaaaacctcacggtttacaccaatgtctccgagactctgctg
ctgacttggagtaacccgtatccccctgataattacctgtatgagaagctcacctatgca
gtcaacatttggaatgaaaacgacccgacagattccagaatctatgacgtgacctaccaa
gaacccaccctccgcattgcagccagcaccctgaaatctggagtttcctacagggcacgg
gtgagggcctgggctcagagctataacagcacctggagtgagtggagccccagcaccaag
tggtataatgcctacaaggagcccttcgagaagcacctcctgctgggcgtcagtgtctcc
tgcgttgtcatcctggccatctgcatgttgtgctatgtcagcatcatcaagattaagaaa
gaatggtgggaccagattcccaacccagctcgcagccccctcgtggccatagtaatccag
gatcctcaggtgtcacagtgggagaagcgcccccgaggccaggaaccagccaagtgccca
cactggaagacttgtcttaccaagctcttgccctgttttctggagcacagcatgaaaagg
gatgaggatcccctcaaggctgccaaagataggcctttccagggctctgaaaaatcagca
tggtgccctgtggagatcagcaagacagttctctggccagagagcatcagcgtggtgcgg
tgcgtggagttgtttgaggccccagtggagtgtgaggaggaggaggtagaggaagataaa
gggagcttctgtgcattgccagagagcagcagggatggcttccaggagggcagggaggcc
attgtggcccggctcacagagagcctgttcctggacctgcttggaggtgagaatggggac
ttttgccagcaggacatgggggagtcatgcctccttccaccttcaggaagcacgagtgct
cacatgccctgggatgagttcccaagtgcagggcccaagggggtgcttccccggggtgag
gagcagcctctgcacctggagcgaagtcctccaggcagcccaacccggagcccagacaac
ccgacttgcacggagacgcccctggtcatcgcagacaaccctgcttaccgcagcttcgac
aactccctgagccggtgcccatgtcccggagagctgggtccagacccactgctggccaga
cacctggaggaagtggaccctgagatgccttgtgccctgcagccctctgagccaaccaat
gtgtcccctcctgagccagaaacctgggagcagatcctccgccggaatgtcctccagcat
ggggcggctgcagcccctgcctcggcccccaccagtggctatcgggagtttgcacatgcg
gtggagcagggtggcatcccggccggtgccatggggggtttgggtcccccgggagagcct
gcgtacaaggctttctcgagcctgcttgccagcaatgccgtgtccccagggacatatgga
tttggggccagcagtggggaggaggggtataagcctttccaagatctcattcctggctgc
cctgaggaccctgccccagtccctgtccccctgtttacctttggactggacagggagcca
cctcgcagcccacagagctcacatctcccaagcagctccccggagcaactgggtctggag
ccaggggtaaaaggagaggacatgtggaagcccccactcctcccagagcaggccatagac
ccccttggggacagcctgggcagtggcatcgtctactcagccctcacctgccacctgtgt
ggccacctgaagcagtgtcatggccaggaagatggtggccaggcccctgtcgtggccagc
ccctgctgtggctgctgctgtggagataggtcgtcaccccctacaacccccctgagagcc
ccagacccctctccaggtgaggttccactggaggccagcctccttccagcctccccggca
ccctcgggcaactcagagaagagtaaatccccactgtccttccatcctgcccctggcagt
gctcagagctcaatccaggtccccaaaatcatgaactttgtctccggggaacccacgttt
atgagggtctcttag

DBGET integrated database retrieval system