KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100412914Help
Entry
100412914         CDS       T03264                                 

Gene name
SELE
Definition
(RefSeq) selectin E
  KO
K06494  selectin, endothelial cell
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04514  Cell adhesion molecules (CAMs)
cjc04668  TNF signaling pathway
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc05143  African trypanosomiasis
cjc05144  Malaria
cjc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100412914 (SELE)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    100412914 (SELE)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100412914 (SELE)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100412914 (SELE)
  09174 Infectious disease: parasitic
   05144 Malaria
    100412914 (SELE)
   05143 African trypanosomiasis
    100412914 (SELE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:cjc04515]
    100412914 (SELE)
   04090 CD molecules [BR:cjc04090]
    100412914 (SELE)
   04091 Lectins [BR:cjc04091]
    100412914 (SELE)
Cell adhesion molecules [BR:cjc04515]
 Selectins
  Selectin family
   100412914 (SELE)
CD molecules [BR:cjc04090]
 Proteins
  100412914 (SELE)
Lectins [BR:cjc04091]
 C-Type lectins
  Group 4: Selectins
   100412914 (SELE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sushi Lectin_C EGF hEGF EGF_2 Plasmod_Pvs28
Motif
Other DBs
NCBI-GeneID: 100412914
NCBI-ProteinID: XP_002760426
Ensembl: ENSCJAG00000010133
UniProt: F7F2X2
Position
18
AA seq 610 aa AA seqDB search
MIASQFLSALTFVLLIKESGAWSYNTSAETMTYDEASAYCQRRYTHLVAIQNKEEIEYLN
SILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEAARNWAPGEPNNKQNDEDCVEIYIKRDK
DVGMWNDERCSKKKLALCYTAACTNTSCSVHGECVETINNYTCKCAPGFSGLKCEQVVNC
PAPESPEHGSLVCTHPLGNFSYNSSCSVSCDRGYQPSSMEATQCMSSGEWSAPIPACNVV
ECDALTNPANGFVDCFPSPGSFPWNTTCAFDCEEGFELMGAQSLQCTSSGNWDNEKPKCK
AVTCRAIPEPQNGSVTCSHSPAGEFTFNSSCNFTCEEGFMLQGSAQVECSTQGTWTPQIP
VCEAFQCTVLSSPERGHMNCLPSASGSFQNGSSCEFSCEQGFVLKGSKRLQCGPTGEWDN
EKPTCEAVRCDAVRQLPRGVVQCAHSPIGEFTYKSSCAFSCEEGFELHGSTRLECTSQGQ
WTQEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWMLNGSAALTCGATGHW
SGLLPICEAPAESHIPLAAGLSAAGISLLTLIPFLLWVRKFLRKAKKFVPASSCQSLESD
GSYQKPSYIL
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcgtcacagtttctctcagctctcacttttgtgcttctcattaaagagagtgga
gcctggtcttacaacacctccgcggaaaccatgacttatgatgaggcaagtgcttactgt
cagcgaaggtacacacatctagttgcaattcaaaacaaagaagagattgagtacctcaac
tccatattgagctattcaccaagctattactggattggaatcagaaaagtcaacaatgtg
tgggtctgggtaggaacccagaaacctttgacagaagcagccaggaactgggctccaggt
gaacccaacaataaacaaaacgatgaggactgcgtggaaatctacatcaagagagacaaa
gacgtgggcatgtggaatgatgagaggtgcagcaagaagaagctggccctgtgctacaca
gctgcctgcaccaatacatcctgcagtgtccacggtgaatgtgtagagaccatcaataat
tacacttgcaagtgtgcccctgggttcagtggactcaagtgcgagcaagttgtgaactgt
ccagccccggaatcccctgagcatggaagcctggtttgcactcacccactgggaaacttc
agctacaattcttcctgctctgtcagctgtgacaggggctaccagccaagcagcatggag
gccacacagtgtatgtcctctggagaatggagtgctcctattccagcctgcaatgtggtt
gagtgtgatgctttgacaaatcctgccaatgggtttgtagactgtttcccaagtcctgga
agcttcccatggaacacaacctgtgcatttgactgtgaagaaggatttgaactaatggga
gcccagagccttcagtgtacctcatctgggaattgggacaatgagaagccaaagtgtaaa
gccgtgacatgcagggctatccccgagcctcagaatggctctgtgacgtgcagccattcc
cctgctggagagttcaccttcaactcttcctgcaacttcacctgtgaggaaggcttcatg
ttgcagggttcagcccaggttgaatgcagcactcaagggacgtggacaccgcaaatccca
gtttgtgaagctttccagtgcacagtcttgtccagccctgagcgaggccacatgaattgt
cttcctagtgcttctggcagcttccagaatgggtccagctgtgagttctcctgtgagcag
ggatttgtgttgaagggctccaaaaggctccagtgtggccccacaggggagtgggacaac
gagaagcccacatgtgaagctgtgagatgtgatgctgttcgccagctcccgaggggtgtg
gtgcagtgtgctcattcccccattggagaattcacctacaagtcctcttgtgccttcagc
tgtgaggagggatttgaattacatggatcaactcgacttgagtgtacatctcagggacag
tggacacaagaggttccttcctgccaagtggtgaaatgttcaagcctggcagttccggga
aagatcaacatgagctgcagtggggagcctgtgtttggcactgtgtgcaagttcgcatgt
cctgaaggatggatgctcaatggctcagcagcgctgacatgtggtgccacaggacactgg
tctgggttgctgcctatctgtgaagctcccgctgaatcccacattcccttggctgctgga
ctttctgctgctggaatctctctcctaacactaataccatttctcctctgggttcggaaa
ttccttcggaaagcaaagaaatttgttcctgccagcagctgccaaagccttgaatcagat
ggaagctaccaaaagccttcttacatcctttaa

DBGET integrated database retrieval system