KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100412922Help
Entry
100412922         CDS       T03264                                 

Gene name
CX3CL1
Definition
(RefSeq) C-X3-C motif chemokine ligand 1
  KO
K05508  C-X3-C motif chemokine 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04062  Chemokine signaling pathway
cjc04668  TNF signaling pathway
cjc05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100412922 (CX3CL1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100412922 (CX3CL1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100412922 (CX3CL1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100412922 (CX3CL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100412922 (CX3CL1)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Chemokines
   100412922 (CX3CL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 100412922
NCBI-ProteinID: XP_008984176
Ensembl: ENSCJAG00000012081
Position
20
AA seq 402 aa AA seqDB search
MAPISLWWLLHLATLCHLTVPLAGQHHGVRKCNITCSKMTSKRIPVTLLIRYQHNQASCG
KPAIILETRENRLFCADPKEKWVQEAKQHLDRQAAARTQNDGTIEKLIGGKTPWTIPAAG
VMEESVVQEPEATGESSRLQLTPSSQEEQRALGTSPELPTGVAVSSGTRIPPTPKAQDGG
PAGTELFRLPPVSTASSWQSSAPHQPGPTSDAPSTQAPSTQAPSTQAPSAPFTQAPTTSS
PAPENTGSEGQPVWRQGQSPRPVPSLEPEMGPVPAHTDALPDWGPGSMAHISVVPVSSEG
TPSREPVTSGSWTPKSEEPIHPTSNSRRQIILITPTSDTQEATRRQAVGLLAFLGLLFCL
GVAMFAYQNLQGCPRKMAGEMVEGLRYVPRSCGSNSYVLVPV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggctccaatatctctctggtggctgctccacttggccaccctctgccatctgactgtc
ccgctggccggacagcaccacggtgtgaggaaatgcaacatcacgtgcagcaagatgacg
tcgaaaaggatacctgtgactttgctcatccgctatcaacataaccaggcatcgtgcggc
aaacctgccatcatcttggagacaagagagaacaggctgttctgtgctgacccgaaggag
aagtgggtccaggaagccaagcagcatctagaccgccaggctgctgctcggactcaaaat
gatggcaccattgagaagctgatcggcgggaagacgccctggaccatccctgccgccggg
gtaatggaggagtccgtggtccaggagcccgaagccacaggtgaaagcagtagactgcag
ctgaccccttcttcacaggaggaacagagggccctggggacctccccagagctgccgacg
ggagtggctgtttcctcagggaccaggatccccccgacaccaaaggctcaggatggaggg
cctgcgggcacggagctttttcgcctgcctcctgtctctactgcttcctcgtggcagagt
tctgctccccaccaacctgggcccacttctgacgccccgtccacccaggccccctccacc
caggccccctccacccaggccccctctgctcccttcacccaggcccccactacttcctcc
ccagccccagagaacactgggtctgaaggccagcccgtgtggaggcagggacagagcccc
aggccagtgccgtctctggagccggagatgggtcccgtgccagcgcacacggatgccctc
ccggactggggacctggcagcatggcccacatctctgtggtccctgtctcctcagaaggg
acacccagcagggagccagtgacttcaggcagctggacccctaagtctgaggaacccatc
catcccacctcaaattcccggaggcagatcatccttatcactcctacctctgacacccag
gaagccaccaggaggcaggcggtggggctgctggccttcctaggcctcctcttctgcctg
ggggtggccatgtttgcctaccagaacctccagggctgccctcggaagatggcgggagag
atggtggaaggccttcgctacgtcccccggagctgtggtagtaactcctatgtcctggtg
cctgtgtga

DBGET integrated database retrieval system