KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100413038Help
Entry
100413038         CDS       T03264                                 

Gene name
USP21
Definition
(RefSeq) ubiquitin specific peptidase 21
  KO
K21634  ubiquitin carboxyl-terminal hydrolase 21 [EC:3.4.19.12]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100413038 (USP21)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cjc01002]
    100413038 (USP21)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cjc04121]
    100413038 (USP21)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100413038 (USP21)
Peptidases [BR:cjc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100413038 (USP21)
Ubiquitin system [BR:cjc04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100413038 (USP21)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1
Motif
Other DBs
NCBI-GeneID: 100413038
NCBI-ProteinID: XP_017821896
Ensembl: ENSCJAG00000005255
UniProt: F7EUN1
Position
18
AA seq 565 aa AA seqDB search
MPQASEHRLGRTREPPVNIQPRVGSKLPFAPRARSKERRNPASGPNPMLRPLPPRPGPPD
ERLKKLELGRGRTSGPRPRGPLRADHGVPLPGSPPPTVALPLPSRTNLTRSKSVSSGDLR
PMGIALGGHRGTGELGAALSRLALRPEPPTLRRSTSLRRLGGFPGPPTLFSIRTEPPASH
GSFHMISARSSEPFYSDDKMAHHTLLLGSGHVGLRNLGNTCFLNAVLQCLSSTRPLRDFC
LRRDFRQEVPGGGRAQELTEAFADVIGALWHPDSCEAVNPTRFRAVFQKYVPSFSGYSQQ
DAQEFLKLLMERLHLEINRRGRRAPPILASGPAPSPPCRGGALLEEPDLSDDDRANLMWK
RYLEREDSKIVDLFVGQLKSCLKCQACGYRSTTFEVFCDLSLPIPKKGFAGGKVSLRDCF
NLFTKEEELESENAPVCDRCRQKTRSTKKLTVQRFPRILVLHLNRFSASRGSIKKSSVGV
DFPLQRLSLGDFASDKAGSPVYQLYALCNHSGSVHYGHYTALCRCQTGWHVYNDSRVSPV
SENQVASSEGYVLFYQLMQEPPRCL
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgccccaggcctctgagcaccgcctgggccggacccgagagccacctgttaatatccag
ccccgagtgggatccaagctaccatttgcccccagggcccgcagcaaggagcgcagaaac
ccagcctctgggccaaaccccatgttacgacctctgcctccccggccaggtccccctgat
gaacggctcaagaaactggagctgggacggggacgtacctcaggccctcgtcccagaggc
ccccttcgagcagatcatggggttcccctgcctggctcaccacccccaactgtggctttg
cctctcccatctcggaccaacttaacccgttccaagtctgtgagcagtggggacttgcgt
ccgatggggattgccttgggagggcaccgtggcaccggagagcttggggctgcgctgagc
cgcttggccctccggcctgagccacccactttgagacgtagcacttctctccgccgccta
gggggctttcctggacccccaaccctgttcagcatacggacagagccccctgcttcccat
ggctccttccacatgatatccgcccggtcctctgagcctttctactctgatgacaagatg
gctcatcacacactgcttctaggctctggtcatgttggccttcgaaacctgggaaacacg
tgcttcttgaatgctgtgctgcaatgtctgagcagcactcgacctcttcgggacttctgt
ctgagaagggacttccggcaagaggtgcctggaggaggccgagcccaagagctcactgaa
gcctttgcagatgtgattggtgccctctggcaccctgactcctgcgaagctgtgaatcct
actcgattccgagctgtcttccagaaatatgttccctccttctctggatacagccaacag
gatgcccaagagttcctgaagctcctcatggagcggctgcaccttgaaatcaaccgccga
ggccgacgggctccaccaatccttgccagcggtccagctccctctccaccctgccgagga
ggggctctgctagaagaacctgacttaagtgatgatgaccgagccaacctaatgtggaaa
cgttacctggagcgagaggacagcaagattgtggacctgtttgtgggccagttgaaaagt
tgtctcaagtgccaggcctgtgggtatcgctccacgaccttcgaggttttttgtgacctg
tccctgcccatccccaagaaaggatttgctgggggcaaggtgtctctgcgggattgtttc
aaccttttcaccaaggaagaagagctagagtcggagaatgccccagtgtgtgaccgatgt
cggcagaaaactcgaagtaccaaaaagttgacagtacaaagattcccccggatccttgtg
ctccatctgaatcgattttctgcctcccgaggctccatcaagaaaagttcagtaggtgta
gactttccactgcaacgactgagcctaggggactttgccagtgacaaagccggaagtcct
gtataccagctgtatgccctttgcaaccactcaggcagcgtccactatggccactacaca
gccctgtgccggtgccagactggttggcatgtctacaatgactctcgtgtctcccctgtc
agtgaaaaccaggtggcatccagcgagggctacgtgctgttctaccaactgatgcaggag
ccaccccggtgcctgtga

DBGET integrated database retrieval system