KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100413151Help
Entry
100413151         CDS       T03264                                 

Gene name
MYD88
Definition
(RefSeq) myeloid differentiation primary response 88
  KO
K04729  myeloid differentiation primary response protein MyD88
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04064  NF-kappa B signaling pathway
cjc04620  Toll-like receptor signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc05132  Salmonella infection
cjc05133  Pertussis
cjc05134  Legionellosis
cjc05140  Leishmaniasis
cjc05142  Chagas disease (American trypanosomiasis)
cjc05143  African trypanosomiasis
cjc05144  Malaria
cjc05145  Toxoplasmosis
cjc05152  Tuberculosis
cjc05161  Hepatitis B
cjc05162  Measles
cjc05164  Influenza A
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Module
cjc_M00686  Toll-like receptor signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100413151 (MYD88)
   04064 NF-kappa B signaling pathway
    100413151 (MYD88)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100413151 (MYD88)
   04621 NOD-like receptor signaling pathway
    100413151 (MYD88)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100413151 (MYD88)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100413151 (MYD88)
   05133 Pertussis
    100413151 (MYD88)
   05134 Legionellosis
    100413151 (MYD88)
   05152 Tuberculosis
    100413151 (MYD88)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100413151 (MYD88)
   05162 Measles
    100413151 (MYD88)
   05164 Influenza A
    100413151 (MYD88)
   05161 Hepatitis B
    100413151 (MYD88)
   05168 Herpes simplex virus 1 infection
    100413151 (MYD88)
   05169 Epstein-Barr virus infection
    100413151 (MYD88)
  09174 Infectious disease: parasitic
   05144 Malaria
    100413151 (MYD88)
   05145 Toxoplasmosis
    100413151 (MYD88)
   05140 Leishmaniasis
    100413151 (MYD88)
   05142 Chagas disease (American trypanosomiasis)
    100413151 (MYD88)
   05143 African trypanosomiasis
    100413151 (MYD88)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIR Death TIR_2
Motif
Other DBs
NCBI-GeneID: 100413151
NCBI-ProteinID: XP_002759780
Ensembl: ENSCJAG00000010193
Position
17
AA seq 296 aa AA seqDB search
MAAEGPGAGSVTPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTVLAEEMDFEYLE
IRQLESHADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQ
QQEEAEKPLQVASVDSSVPRTTELAGITTLDDPLGQMPERFDAFICYCPSDIQFVQEMIR
QLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFA
LSLSPGAHQKRLIPIKYKAMNKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagaaggtcccggcgcggggtctgtgaccccggtatcctccacatcctccctg
cccctggctgctctcaacatgcgagtgcggcgccgcctgtcgctgttcttgaacgtgcgg
acgcaggtggcagccgactggaccgtgctggcggaggaaatggactttgagtacttggag
atccggcagctggaatcgcacgccgaccccacgggcaggctgctggacgcctggcaggga
cgccccggtgcctcggtaggccgactgctggagctgctcaccaagctgggccgcgacgac
gtgctgctggagctgggacccagcattgaggaggattgccaaaagtatatcttgaagcag
cagcaggaggaggctgagaagccgttacaggtggcctctgttgacagcagtgtcccacgg
acaacagagctggcgggcatcaccacacttgacgaccccctggggcaaatgcctgagcgt
ttcgatgccttcatctgctattgccccagcgacatccagtttgtgcaggagatgatccgg
caactggaacagacaaactatcgactgaagttatgtgtgtctgaccgcgatgtcctgcct
ggcacctgtgtctggtctattgctagtgagctcatcgagaagaggtgccgccggatggtg
gtggttgtctctgatgattacctgcagagcaaggaatgtgacttccagaccaaatttgca
ctcagcctctctccaggtgcccatcagaagcgactgatccccatcaagtacaaggcaatg
aacaaagagttccccagcatcctgaggttcatcaccgtctgcgactacaccaatccctgc
accaaatcttggttctggactcgccttgccaaggccctgtccctgccctga

DBGET integrated database retrieval system