KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100413251Help
Entry
100413251         CDS       T03264                                 

Gene name
JAK2
Definition
(RefSeq) Janus kinase 2
  KO
K04447  Janus kinase 2 [EC:2.7.10.2]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01521  EGFR tyrosine kinase inhibitor resistance
cjc04062  Chemokine signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04217  Necroptosis
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04630  Jak-STAT signaling pathway
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc04725  Cholinergic synapse
cjc04917  Prolactin signaling pathway
cjc04920  Adipocytokine signaling pathway
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc05140  Leishmaniasis
cjc05145  Toxoplasmosis
cjc05152  Tuberculosis
cjc05161  Hepatitis B
cjc05164  Influenza A
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05200  Pathways in cancer
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Module
cjc_M00684  JAK-STAT signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    100413251 (JAK2)
   04151 PI3K-Akt signaling pathway
    100413251 (JAK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100413251 (JAK2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100413251 (JAK2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100413251 (JAK2)
   04659 Th17 cell differentiation
    100413251 (JAK2)
   04062 Chemokine signaling pathway
    100413251 (JAK2)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100413251 (JAK2)
   04917 Prolactin signaling pathway
    100413251 (JAK2)
  09156 Nervous system
   04725 Cholinergic synapse
    100413251 (JAK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100413251 (JAK2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100413251 (JAK2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100413251 (JAK2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100413251 (JAK2)
  09172 Infectious disease: viral
   05164 Influenza A
    100413251 (JAK2)
   05161 Hepatitis B
    100413251 (JAK2)
   05168 Herpes simplex virus 1 infection
    100413251 (JAK2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100413251 (JAK2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100413251 (JAK2)
   05140 Leishmaniasis
    100413251 (JAK2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100413251 (JAK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100413251 (JAK2)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100413251 (JAK2)
Protein kinases [BR:cjc01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   100413251 (JAK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase FERM_F2 FERM_F1 Jak1_Phl SH2 RIO1 Kinase-like FERM_M
Motif
Other DBs
NCBI-GeneID: 100413251
NCBI-ProteinID: XP_002742952
Ensembl: ENSCJAG00000011228
Position
1
AA seq 1130 aa AA seqDB search
MACLTVTEMEGTSTSSINQNGDISGNVNSMKQIDPVLQVYLYHSLGKAEADYLTFPSGEY
VAEEICIAASKACGITPLYHNMFALMSETERIWYPPNHVFHVDESTRDNVLYRIRFYFPH
WYCSGNNRTYRHGISRGAEAPLLDDCVMSYLFSQWRHDFVHGWIKVPVTHETQEECLGMA
VLDMMRIAKEKDQTPLAIYNSISYKTFLPKCIRAKIQDYHILTRKRIRYRFRRFIQQFSQ
CKATARNLKLKYLINLETLQSAFYTEKFEVKEPGSGPSGEEIFATIIITGNGGIQWSRGK
HKESETLTAQDLQLYCDFPNIIDVSIKQANQEGSNESRVVTIHKQDGKNLEIELSSLREA
LSFVSLIDGYYRLTADAHHYLCKEVAPPTVLENIQSNCHGPISMDFAISKLKKAGNQTGL
YVLRCSPKDFNKYFLTFAVERENVIEYKHCLITKNENEEYNLSGTKKNFSSLKDLLNCYQ
METVRSDNIIFQFTKCCPPKPKDKSNLLVFRMNGVSDVPISPTLQRHNNVNQMVFHKIRN
EDLIFNESLGQGTFTKIFKGIRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAASMMS
QLSHKHLVLNYGICVCGEENILVQEFVKFGSLDTYLKKNKNCINILWKLEVAKQLAWAMH
FLEEKTLIHGNVCAKNILLIREEDRKTGNPPFIKLSDPGISITVLPKDILQERIPWVPPE
CIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKWAELAN
LINNCMDYEPDFRPSFRAVIRDLNSLFTPDYELLTENDMLPNTRTGLSGFSVAFEDRDPT
QFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEIL
KSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHKKLLQYTSQICK
GMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFWYA
PESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELL
KNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAE
NT seq 3393 nt NT seq  +upstreamnt  +downstreamnt
atggcttgccttacagtgacagaaatggagggaacatccacgtcttctataaatcagaat
ggtgatatttctggaaatgtcaattctatgaagcaaatagatccggttcttcaggtgtat
ctttaccattcccttgggaaagctgaggcagattatctcacatttccatctggggaatat
gttgcagaagaaatctgtattgctgcttctaaagcttgtggcatcacacctttgtatcat
aatatgtttgctttaatgagtgaaacagaaaggatctggtatccacccaaccatgtcttc
catgtagatgaatcaaccagggataatgtactctacagaataagattttactttcctcat
tggtattgcagcggcaacaacagaacctatcggcatggaatatctcgaggtgctgaagct
cctcttctcgatgactgtgtcatgtcttaccttttttctcagtggcggcatgattttgtg
catggatggataaaagtacctgtgactcatgaaactcaggaagaatgtcttgggatggca
gtgttagatatgatgagaatagctaaagaaaaggatcagactccactggccatctataat
tctatcagctacaagacattcttaccaaaatgtattcgagcaaagatccaagactatcac
attttgacaaggaagcgaataaggtacagatttcgcagatttattcagcagttcagccaa
tgcaaagccactgccagaaacttgaaacttaagtatcttataaatctggaaactctgcag
tctgccttctacacagagaaatttgaagtaaaagaacctggaagtggtccttcaggtgag
gagatttttgcaaccattataataactggaaacggtggaattcagtggtcaagagggaaa
cataaagaaagtgagacactgacagcacaggatttacagttgtattgtgattttcctaat
attattgatgtcagtattaagcaagcaaaccaagagggttcaaatgaaagcagagttgtg
actatccataagcaagatggtaaaaatctggaaattgaacttagctcattaagggaagct
ttgtcttttgtgtcattaattgatggatattatagattaacggcagatgcacatcattac
ctctgtaaagaagtagcacctccaacggtgcttgaaaatatacaaagcaactgtcatggc
ccaatttcaatggactttgccatcagtaaactgaagaaagcaggcaatcagactggactg
tatgtacttcgatgcagtcctaaggacttcaataaatattttctgacttttgctgtcgag
cgagaaaatgtcattgaatataaacactgtttgattacaaaaaatgagaatgaagagtac
aacctcagtgggacaaagaagaacttcagtagtcttaaagatcttttgaattgttaccag
atggaaactgttcgctcagacaatataattttccagtttactaaatgctgtcccccaaag
ccaaaagataaatcaaaccttctagtcttcagaatgaatggtgtttctgatgtcccaatc
tcaccaacattacagaggcataataacgtgaaccaaatggtgtttcacaaaattagaaat
gaagatttgatatttaatgaaagccttggccaaggcacttttacaaagatttttaaaggc
atacgaagagaagtaggagattatggccaactgcatgaaacagaagttcttttaaaagtt
ctggataaagcacatagaaactattcagagtctttctttgaagcagcaagcatgatgagc
cagctttctcacaagcatttggttttaaattatggaatatgtgtctgcggagaggagaat
attctggttcaggagtttgtaaaatttggatcactagatacatacctgaaaaagaataaa
aattgtataaatatattatggaaacttgaagttgctaaacagttggcatgggccatgcat
tttctagaagaaaagacccttattcatgggaatgtgtgcgccaaaaatattctacttatc
agagaagaagacaggaagacaggaaatcctcctttcatcaaactcagtgaccctggcatt
agtattacagttttgccaaaggacattcttcaggagagaataccatgggtaccacctgaa
tgcattgaaaatcctaaaaatttaaatttggcaacagacaaatggagttttggtaccact
ttgtgggaaatctgcagtggaggagataaacccttaagtgctctggattctcaaagaaag
ctgcaattttatgaagataggcaccagcttcctgcaccaaagtgggcagaattagcaaac
cttataaataattgtatggattatgaaccagatttcaggccttccttcagagccgtcata
cgagatcttaacagtttgtttacaccagattatgaactattaacagaaaatgacatgtta
ccaaatacgaggacaggtctttcagggttttctgttgcttttgaagacagggatcctaca
cagtttgaagagagacatttgaaatttctacagcaacttggcaagggtaattttgggagt
gtggagatgtgccgatatgaccctctacaggacaacactggggaggtggtggctgtaaaa
aagcttcagcatagtactgaagagcacctgagagactttgaaagggaaattgaaatcttg
aaatcactgcagcatgacaacattgtaaagtacaagggagtgtgctacagtgctggtcgg
cgaaatctaaaattaattatggaatatttaccatatggaagtttacgagactatcttcaa
aaacataaagaacggatagatcacaaaaaacttctgcagtacacatctcagatctgcaag
ggtatggagtatcttggtacaaaaaggtatatccacagggatctggcgacaagaaatata
ttggtagagaatgagaacagagttaaaattggagattttgggttaaccaaagtcttgcca
caagacaaagaatactataaagtaaaagaacctggtgaaagccccatattctggtatgct
ccagaatcactgacagagagcaagttttctgtggcctcagatgtttggagctttggagta
gttctgtatgaacttttcacatacattgagaagagtaaaagtccaccagcggaatttatg
cgtatgattggcaatgacaaacaaggacagatgatcgtgttccatttgatagaactgttg
aagaataatggaagattaccaagaccagatggatgcccagatgagatttatatgatcatg
acagaatgctggaacaataatgtaaatcaacgcccctcctttagggatctagctcttcga
gtggatcaaataagggataacatggctgaataa

DBGET integrated database retrieval system