KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100413467Help
Entry
100413467         CDS       T03264                                 

Gene name
RASGRF1
Definition
(RefSeq) Ras protein specific guanine nucleotide releasing factor 1
  KO
K04349  Ras-specific guanine nucleotide-releasing factor 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04014  Ras signaling pathway
cjc04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100413467 (RASGRF1)
   04010 MAPK signaling pathway
    100413467 (RASGRF1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100413467 (RASGRF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGEF RhoGEF PH RasGEF_N GOLGA2L5 PH_13 PH_11 IQ Sec34
Motif
Other DBs
NCBI-GeneID: 100413467
NCBI-ProteinID: XP_002807227
Ensembl: ENSCJAG00000002316
UniProt: U3D3S6
Position
10
AA seq 1259 aa AA seqDB search
MQKGIRLNDGHVASLGLLARKDGTRKGYLSKRSSDNTKWQTKWFALLQNLLFYFESDSSS
RPSGLYLLEGCVCDRAPSPKPALSAKEPLEKQHYFTVNFSHENQKALELRTEDAKDCDEW
VAAIAHASYRTLATEHEALMQKYLHLLQIVETEKTVAKQLRQQIEDGEIEIERLKAEIAS
LLKDNERIQSTQTVAPNDEDSDIKKIKKVQSFLRGWLCRRKWKTIIQDYIRSPHADSMRK
RNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMFLH
QIFYQGLKARISSWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDKLL
KHYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLDYAKSKLEELS
RIMHDEVSETENIRKNLAIERMIIEGCEILLDTSQTFVRQGSLIQVPMSEKGKITRGRLG
SLSLKKEGERQCFLFSKHLIICTRGSGGKLHLTKNGVISLIDCTLLEEPESTEEEAKGSG
SGQDIDHLDFKIGVEPKDSPPFTVILVASSRQEKAAWTSDISQCVDNIRCNGLMMNAFEE
NSKVTVPQMIKSDASLYCDDVDIRFSKTMNSCKVLQIRYASVERLLERLTDLRFLSIDFL
NTFLHSYRVFTTAIVVLDKLITIYKKPISAIPARSLELLFASGQNNKLLYGDPPKSPRAT
RKFSSPPPLSITKTSSPSRRRKLSLNIPIITGGKALDLAALSCNANGYTSMYSAMSPFSK
ATLDTSKLYVSSSFTNKIPDEGDTTPEKPEDPSVLSKQSSEVSVREESDIDQNQSDDGDT
EASPTKSPTTPKSVKSRNSSEFPLFSYNNGVVMTSCRELDNNRSALSAASAFAIATAGAN
EGTPNKEKYRRMSLASAGFPPDQRNGDKEFVIRRAATNRVLNVLRHWVSKHSQDFETNDE
LKCRVISFLEEVMHDPELLTQERKAAANIIRTLTQEDPGDNQITLEEITQMAEGVKAEPF
ENHSALEIAEQLTLLDHLVFKKIPYEEFFGQGWMKVEKNERTPYIMKTTKHFNDISNLIA
SEIIRNEDINARVSAIEKWVAVADICRCLHNYNAVLEITSSMNRSAIFRLKKTWLKVSKQ
TKALIDKLQKLVSSEGRFKNLREALKNCDPPCVPYLGMYLTDLAFIEEGTPNYTEDGLVN
FSKMRMISHIIREIRQFQQTAYKIEHQAKVTQYLLDQSFVMDEESLYESSLRIEPKLPT
NT seq 3780 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaggggatccggctgaacgatggccacgtcgcgtccctgggactgctggcgcgc
aaggacggcacgcgcaaaggctacctgagcaagcggagttcggacaacacaaaatggcaa
accaagtggttcgcgctgctgcagaacctgctcttctacttcgagagcgactcgagctcg
cggccctcggggctttacctgctcgagggctgcgtctgcgaccgcgcgccctcccccaag
ccggcgctgtcggccaaggagccgctggagaaacagcattacttcacagtgaacttcagc
catgagaaccagaaagccttggagctgaggacagaggatgcgaaagactgtgatgaatgg
gtggcagctattgcacatgccagctacaggaccctggccaccgagcatgaggcgctcatg
cagaagtatctgcacctgctgcagatcgtggagactgagaagaccgtagcgaagcagctt
cggcagcaaatcgaggacggggagatagagatcgagcggctcaaggcagagattgcatcc
ctgctcaaagacaatgagcgcatccagtccacccagaccgtcgcccccaatgatgaagac
agtgacatcaagaaaattaagaaggtgcagagcttcctgcgcggctggctgtgccggcga
aagtggaagaccatcatccaggactacatccggtccccccacgccgacagcatgcgcaag
cggaaccaagtggtgttcagcatgctggaggccgaggccgagtacgtgcagcagctgcac
atccttgtcaacaacttcctgcgcccgctacggatggctgccagctccaagaagcctccc
atcactcatgatgacgtcagcagcatcttcctgaacagtgaaaccatcatgtttttgcat
cagatcttttaccaaggactgaaggctcgcatctccagctggcccacgctggtcctggcc
gacctgtttgatatcctgctgcccatgctgaacatctaccaagagttcgtccgaaaccac
cagtacagcctgcagatcctggcccactgcaagcagaaccgcgactttgacaagctgctg
aagcactacgaggccaagccagactgcgaggagaggacgctcgagaccttcctcacctac
cccatgttccagatccccaggtacatcctgaccctccacgagctcctggcccacacgcct
cacgagcacgtcgagcgcaacagcctggactacgccaagtccaaactggaggagctgtcc
aggataatgcacgatgaagtcagtgagacagagaacatccggaaaaacctggccatcgag
cgcatgatcatcgaaggctgtgagatccttctggacaccagccagacctttgtgagacaa
ggttccctcatccaggtgcccatgtccgaaaagggcaagatcaccagggggcgcctgggg
tctctgtccctaaagaaagagggtgagcgacagtgcttcctgttttctaagcatctgatt
atctgtaccagaggttctggagggaagcttcacctgaccaagaatggagtcatatccctc
attgactgcactttattggaggagccagaaagcacagaggaggaagccaaaggatccggt
tctggccaagacatagatcacctggattttaaaatcggagtggagccaaaagattcccca
ccctttacagtcatcctagtggcctcgtccagacaggagaaggcggcgtggaccagtgac
atcagccagtgtgtggataacatccggtgcaatgggctcatgatgaacgcgtttgaagaa
aattccaaggtcactgtaccacagatgatcaagtccgacgcctccttatattgtgatgat
gttgacattcgcttcagcaaaaccatgaactcctgcaaagtgctgcagatccgctatgcc
agcgtggagcggctgctggagaggctgacggacctgcgcttcctgagcattgacttcctc
aacaccttcctgcactcctaccgtgtcttcaccactgccatcgtggtcctggacaagctc
atcaccatctacaagaagcctatcagtgccatccctgccaggtcgctggagctcctgttt
gccagcggccagaacaacaagcttctgtacggtgacccccccaagtccccgcgcgccacc
cgcaagttctcctcgccaccacccctgtccatcaccaagacgtcgtcacccagccgccgg
cggaagctctccctgaacatccccatcatcaccggcggcaaggccctggacctggccgcc
ctcagctgcaacgccaacggttacaccagcatgtactcggccatgtcacccttcagcaag
gccacgctggacaccagcaagctctacgtgtccagcagcttcaccaacaagattccagat
gaaggcgatacaacccctgagaagcccgaagacccctcagtgctcagcaagcagagctca
gaagtctccgtgagagaggagtcagatattgaccaaaaccagagtgatgacggtgacact
gaagcatcaccaactaaatctccaacaacacccaaatcagtcaaaagcagaaattcttca
gagttcccgctcttttcctataacaatggagtcgtcatgacctcctgtcgcgaactggac
aataaccgcagtgccttgtcggccgcgtccgcctttgccatagcaaccgcgggggccaac
gagggcaccccaaacaaggagaaataccggaggatgtccttagccagtgccgggttcccc
ccagaccagaggaatggagacaaggagtttgtgatccgccgagcagccaccaatcgtgtc
ctgaacgtgctccgccactgggtgtccaagcactctcaggactttgagaccaatgatgag
ctcaaatgcagggtgatcagcttcctggaagaagttatgcatgacccggagctcctgacg
caggagcggaaggccgcggccaacatcatcaggactctgacccaggaggacccaggtgac
aaccagatcacgctggaggagatcacgcagatggctgaaggcgtgaaggctgagcccttt
gaaaaccactcggccctggagatcgcggagcagctgaccctgctagaccacctcgtcttc
aagaagattccttatgaggagttcttcggacaaggctggatgaaagtggaaaagaatgaa
aggaccccttacatcatgaagaccaccaagcacttcaatgacatcagtaacctgattgct
tctgaaatcatccgcaatgaagacatcaacgcgagggtgagcgccattgagaagtgggtg
gccgtggctgacatatgccgctgcctccacaactacaatgccgtgctggagatcacctca
tccatgaaccgcagtgcaatcttccggctcaaaaagacgtggctcaaagtctctaagcag
actaaagctttgattgataagctccaaaagcttgtgtcatctgagggcagatttaagaat
ctcagagaagctctgaaaaattgtgacccaccctgtgtcccttacctggggatgtacctc
accgacctggccttcatcgaggaggggacgcccaattacacggaggatggtctggtcaac
ttctccaagatgaggatgatatcccatattatccgagagattcgccagtttcaacaaact
gcctacaaaatagagcaccaagcaaaggtaacgcagtatttactggaccagtcttttgta
atggatgaagaaagcctctacgagtcttccctccgaatagaaccaaaactccccacctga

DBGET integrated database retrieval system