KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100413494
Entry
100413494         CDS       T03264                                 
Symbol
RECK
Name
(RefSeq) reversion-inducing cysteine-rich protein with Kazal motifs isoform X1
  KO
K17461  reversion-inducing-cysteine-rich protein with kazal motifs
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100413494 (RECK)
SSDB
Motif
Pfam: Kazal_1 Kazal_2 Ldl_recept_a
Other DBs
NCBI-GeneID: 100413494
NCBI-ProteinID: XP_002743119
Ensembl: ENSCJAG00000010143
UniProt: U3ENV3
Position
1:139995029..140083030
AA seq 971 aa
MATVRASLRGAPLLLLAVAGVVEVAGGLTPGSAGALCCNHSKDNQMCRDVCEQIFSSKSE
SRLKHLLQRAPDYCPETMVEIWSCMNSSLPGVFKKSDGWVGLGCCELAIALECRQACKQA
SSKNDISKVCRKEYENALFSCISRNEMGSVCCSYAGHHTNCREYCQAIFRTDSSPGPSQI
KAVENYCASISPQLIHCVNNYTQSYPMRNPTDSLYCCDRAEDHACQNACKRILMSKKTEM
EIVDGLIEGCKTQPLPQDPLWQCFLESSQSVHPGVTVHPPPSTGLDGAKLHCCSKANTST
CRELCTKLYSMSWGNTQSWQEFDRFCEYNPVEVSMLTCLADVREPCQLGCRNLTYCTNFN
NRPTELFRSCNAQSDQGAMNDMKLWEKGSIKMPFINIPVLDIKKCQPEMWKAIACSLQIK
PCHSKSRGSIICKSDCVEILKKCGDQNKFPEDHTAESICELLSPTDDLKNCIPLDTYLRP
STLGNIVEEVTHPCNPNPCPANELCEVNRKGCLSGDPCLPYSCVQGCKLGEASDFIVRQG
TLIQVPSSAGEVGCYKICSCGQSGLLENCMEMHCIDLQKSCIVGGKRKSHGTSFSIDCNV
CSCFAGNLVCSTRLCLNEHSSEDDHRTFTGLPCNCADQFVPVCGQNGRTYPSACIARCVG
LQDHQFEFGSCMSKDPCNPNPCQKNQRCIPKPQVCLTTFDKFGCSQYECVPRQLVCDQVR
DPVCDTDHMEHSNLCILYQRGKSLSYKGPCQTFCRETEPVCGHNGETYSSVCAAYSDRVA
VDYYGDCQAVGVLSEHSSVTECAAVKCPLLSAAGCKPIIPPGACCPLCAGMLRVLFDKEK
LDTIAKVTNKKPVTVLEILQKIRMHVSVPQCDVFGYFSIESEIVILIIPVDHYPKALQIE
ACNKEAEKIESLINSDSPTLASHVPLSALIISQVQVSSSVPSAGVRARPFCHSFLLPLSL
GLALHLLWTCN
NT seq 2916 nt   +upstreamnt  +downstreamnt
atggcgaccgtccgggcctctctacgaggcgcgccgcttcttctgctggccgtggcgggg
gtggtggaggtggcagggggcctgaccccgggcagtgcgggtgcattgtgttgtaatcat
tcaaaggataaccaaatgtgccgtgatgtatgcgaacagattttctcctcaaaaagtgaa
tcccgactaaaacatttgctgcagcgagccccagattattgcccagagacaatggttgaa
atttggagttgtatgaattcatctttgccaggtgtgtttaagaagtctgatggctgggtt
ggcttaggctgctgtgaactggctattgccttggagtgtcgacaggcatgcaagcaggca
tcttcaaagaatgatatttccaaagtttgcagaaaagaatatgagaatgctcttttcagt
tgcattagcagaaatgaaatgggctcggtttgttgcagttatgcaggtcaccacacaaac
tgccgagaatactgtcaagccatttttcgaacagactcttctcctggtccgtctcagatc
aaagcagtggaaaattattgtgcttctattagtccacaattaatacattgtgtgaataat
tatactcagtcttatccaatgaggaacccaacagatagtttatattgctgtgacagagcc
gaagaccatgcttgccaaaatgcctgcaagagaattctcatgtccaagaaaacagaaatg
gagattgttgatggtctcatcgagggttgtaagacccagcccttgcctcaagatcctctt
tggcagtgttttcttgaaagctcacaatctgttcaccctggagtcactgtacaccctcct
ccctctactggccttgatggggctaaactgcattgttgttctaaagcaaacacttcaaca
tgtagggaactctgcactaaactttacagcatgagctggggcaatacacagagttggcaa
gagtttgatcgtttttgtgaatataatccagtggaagtgtctatgttgacctgtttagcg
gatgtccgggaaccttgccagttgggctgtagaaaccttacttactgtactaattttaac
aacaggccaacagaacttttcaggagttgtaatgcacagtcagatcaaggagccatgaat
gacatgaagctgtgggagaaaggaagcataaagatgccatttatcaatatacctgttctt
gatataaaaaagtgccagccagagatgtggaaagcaatagcttgttcactgcagattaaa
ccttgtcatagtaaatcccggggcagtattatttgcaaatcagattgtgtggagattctt
aaaaaatgtggagaccagaacaaattccctgaagaccacacagctgaaagtatttgtgag
cttctgtcacctacagatgatctgaagaactgtatacctttggatacatatcttagacca
agtactttaggtaacattgtagaagaagtgactcatccctgtaacccaaatccttgccct
gccaacgagctctgtgaagtaaaccgaaaaggatgtctatctggagatccctgtctccca
tactcttgtgttcaaggttgcaaactgggagaagcttctgatttcattgtacgtcaaggg
acactaatccaggtgccatcatctgcaggggaagttggttgttacaaaatctgttcatgt
ggacaaagtggactcttagaaaactgtatggaaatgcactgtatagacctccaaaagtct
tgtattgttggaggaaaaagaaaaagtcatgggacatcctttagtattgactgcaatgtc
tgttcttgttttgctggcaatttggtgtgttctacccgcctttgcctcaatgagcacagt
tcagaagatgaccatcgtaccttcacaggtctgccctgtaactgtgcagatcagtttgtc
cccgtgtgtgggcagaatgggcgcacttaccccagtgcctgcattgctcgctgtgtgggc
ctccaagaccatcagtttgagtttggatcatgcatgtcaaaggatccatgtaatcctaat
ccctgccaaaaaaaccaaaggtgcatacccaaaccacaggtctgcctgacaacttttgat
aaatttggatgtagccaatatgaatgtgtaccaagacagctcgtgtgtgaccaggtccga
gatcctgtttgtgacacagaccacatggagcacagtaatctctgcattttataccaaaga
ggaaaaagcctctcttacaaaggcccctgccagaccttctgcagagagaccgagcccgtc
tgtgggcacaatggtgaaacctatagcagtgtatgtgctgcctactcagatcgagtggcg
gttgattactatggggactgccaggctgttggggtcctctcagagcacagctctgtcacc
gagtgtgccgctgtcaagtgtcctttgctctcagcagctggatgcaaacccatcatccca
ccaggtgcttgttgcccattatgtgctgggatgttaagagttttatttgacaaagaaaaa
ctggatactattgctaaggtaacaaataaaaagccagtaacagttctggaaatacttcaa
aaaatccgcatgcacgtgtctgtcccacagtgtgatgtgtttggatacttcagcattgaa
tcagaaattgtgatcctgatcattcctgtcgatcactatccaaaagctctgcagattgaa
gcctgcaataaagaagctgagaagattgagtcccttatcaactctgacagcccgactttg
gcatcccatgtccctctctctgccctcatcatttcccaggtacaggtctccagcagtgtg
ccatcggccggtgttagagccagacctttttgccactccttcctccttcccctcagcctg
ggccttgccttgcacttgctctggacatgtaactga

DBGET integrated database retrieval system