KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100413804Help
Entry
100413804         CDS       T03264                                 

Gene name
IL15RA
Definition
(RefSeq) interleukin 15 receptor subunit alpha
  KO
K05074  interleukin 15 receptor alpha
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04630  Jak-STAT signaling pathway
cjc04672  Intestinal immune network for IgA production
cjc05166  Human T-cell leukemia virus 1 infection
cjc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    100413804 (IL15RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100413804 (IL15RA)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    100413804 (IL15RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100413804 (IL15RA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100413804 (IL15RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:cjc04050]
    100413804 (IL15RA)
   04090 CD molecules [BR:cjc04090]
    100413804 (IL15RA)
Cytokine receptors [BR:cjc04050]
 Interleukin receptor families
  IL2 receptor family
   100413804 (IL15RA)
CD molecules [BR:cjc04090]
 Proteins
  100413804 (IL15RA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sushi
Motif
Other DBs
NCBI-GeneID: 100413804
NCBI-ProteinID: XP_008998126
Position
7
AA seq 363 aa AA seqDB search
MGKVLGTHRARPAASRGQGWLCGATAACGAPSPAGVGTLSHGSVTALHLSAALRGPKQNR
KRMRLAGRQVPERRSPXSPGLGSARPGRPAGPCEAAAMARQRARGCRTLGLPALLLLLLL
LQPPATLGITCPAPMSVEHADIQVKSYSLHSRERYICNSGFKRKAGTSSLTECVLNKATN
IAYWTTPSLKCIRDPALARQRPAPPSTVTTAGVTPQPESFSPSGKEPAASSPRSDTTVAT
TAALGPGSRLMPSKSPSTGTTRIGSHESSHGPSQMTARTWELTAHASHQPPDGYPPGNSS
TIVAVSTSTILLCGLSAVSLLACYIKSRQTPQPDSVEMEAMEALPVTGGTSDRDKDSENR
THL
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaggtcctggggacccaccgggcacggcccgcggcgtcccgaggacaggggtgg
ctgtgcggggccacagcggcctgtggggctccttccccagcaggggtggggactctgagt
cacggatctgtcactgctctgcacctctccgcagccctccgggggccaaagcaaaaccga
aagcgaatgcgcctggcgggacggcaagtcccagagcggcgctcgccangctccccgggc
ctgggcagcgctcgcccggggcgcccagcggggccctgcgaagcggcagccatggcccgg
cagcgggcgcgcggctgcaggaccctgggcctcccggcgctgctactgctgctgctgctg
ctccagccgccggcgacgctgggcatcacatgccccgcccccatgtccgtggaacatgca
gacatccaggtcaagagctacagcttgcactccagggagcggtacatttgtaactctggt
ttcaagcgtaaagccggtacatccagcctgactgagtgcgtgttgaacaaggccaccaac
atcgcctactggacaacccccagtctcaaatgcatcagagaccccgccctggctcgccaa
aggccagcaccaccctccacagtaacgacggcaggggtgaccccgcagccagagagcttc
tccccttctggaaaagagcctgcagcttcatctcccaggtcagacaccacagtggccaca
acagcagctcttggcccgggctcccggctgatgccttcaaagtcaccttccacgggaacc
acaaggataggcagtcatgagtcctcccacggcccctctcaaatgacagccaggacctgg
gaactcacagcacatgcttcccaccagccgccagatgggtatccaccgggcaacagcagc
accatagtggccgtttccacttccaccatcctgctgtgtgggctgagtgctgtgtctctc
ctggcatgctacataaagtcaaggcaaactccccagccagacagcgttgaaatggaagcc
atggaagctctgccagtgaccggagggaccagcgacagagacaaagactcagaaaaccgc
actcacctctga

DBGET integrated database retrieval system