KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100414089Help
Entry
100414089         CDS       T03264                                 

Gene name
POMC
Definition
(RefSeq) proopiomelanocortin
  KO
K05228  proopiomelanocortin
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04024  cAMP signaling pathway
cjc04080  Neuroactive ligand-receptor interaction
cjc04915  Estrogen signaling pathway
cjc04916  Melanogenesis
cjc04920  Adipocytokine signaling pathway
cjc04925  Aldosterone synthesis and secretion
cjc04927  Cortisol synthesis and secretion
cjc04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100414089 (POMC)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100414089 (POMC)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100414089 (POMC)
   04915 Estrogen signaling pathway
    100414089 (POMC)
   04916 Melanogenesis
    100414089 (POMC)
   04925 Aldosterone synthesis and secretion
    100414089 (POMC)
   04927 Cortisol synthesis and secretion
    100414089 (POMC)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100414089 (POMC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACTH_domain NPP Op_neuropeptide ACTH_assoc
Motif
Other DBs
NCBI-GeneID: 100414089
NCBI-ProteinID: XP_002758032
Position
14
AA seq 265 aa AA seqDB search
MLRSCCSRSGALLLALLLQVSMEVRGWCLESSQCQDLTTESNLLECIRACKPDLSAETPV
FPGNGDEQPLTENPRKYVMSHFRWDRFGRRNSSSGGGAGQKREDFAAGEDRGLLPEDGPE
PRSDGAEPGPREGKRSYSMEHFRWGKPVGKKRRPVKVYPNSAENESAEAFPLEFKRELND
QRPLAGDGPDSPTDDEARREADLEHGLLVAAEKKDEGPYRMEHFRWGSPPKDKRYGGFMT
SEKSQTPLVTLFKNAIIKNAYKKGQ
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgctgagatcgtgttgcagccgctcaggggccctgttgctggccttgctgcttcaggtc
tccatggaagtgcgtggctggtgcctggagagcagccagtgtcaggatctcaccaccgaa
agcaacctgctggagtgcatccgggcctgcaagcccgacctctcggctgagactccagtg
ttccctggcaatggtgacgagcagccgctgaccgagaaccctcggaagtacgtcatgagc
cacttccgctgggaccgcttcggtcgccgcaatagcagcagcggcggcggcgcagggcag
aagcgcgaggacttcgcggcgggcgaagaccgcggcctgctccctgaggacggccccgag
ccccgcagcgatggcgcggagccgggcccgcgcgagggcaagcgctcctactccatggag
cacttccgctggggcaagccggtgggcaagaagcggcgccctgtgaaggtgtaccccaac
agcgccgagaacgagtcggccgaggccttccccctggagttcaagagggagttgaacgac
cagcggcccctggcgggagatggccccgacagccctaccgacgacgaggcgcggcgcgag
gccgacctggagcacggcctgctggtggcggctgagaagaaagacgaaggaccgtacagg
atggagcacttccgctggggcagcccgcccaaggacaagcgctacggcggcttcatgacc
tccgagaagagccagacgcccctggtgacgctgttcaaaaacgccattatcaagaacgcc
tacaagaagggccagtga

DBGET integrated database retrieval system