KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100414179Help
Entry
100414179         CDS       T03264                                 

Gene name
IL23A
Definition
(RefSeq) interleukin 23 subunit alpha
  KO
K05426  interleukin 23 subunit alpha
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04625  C-type lectin receptor signaling pathway
cjc04630  Jak-STAT signaling pathway
cjc04659  Th17 cell differentiation
cjc05133  Pertussis
cjc05152  Tuberculosis
cjc05200  Pathways in cancer
cjc05321  Inflammatory bowel disease (IBD)
cjc05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    100414179 (IL23A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100414179 (IL23A)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100414179 (IL23A)
   04659 Th17 cell differentiation
    100414179 (IL23A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100414179 (IL23A)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100414179 (IL23A)
   05321 Inflammatory bowel disease (IBD)
    100414179 (IL23A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100414179 (IL23A)
   05152 Tuberculosis
    100414179 (IL23A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100414179 (IL23A)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interleukins
   100414179 (IL23A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL23 IL6
Motif
Other DBs
NCBI-GeneID: 100414179
NCBI-ProteinID: XP_002752654
Ensembl: ENSCJAG00000011123
UniProt: A0A2R8N533
Position
9
AA seq 189 aa AA seqDB search
MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCMLAWSAHPLVGHMHLREEG
DEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSP
VGQLHASLLGLSQLLQPEGHHWETQQIPSPGPSQPWQRLLLRFKILRSLQAFVAVAARVF
AHGAATLSP
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgctggggagcagagctgtaatgctgctgttgctgctgccctggacagctcagggcagg
gctgtgcctgggggcagcagccctgcctggactcagtgccagcagctctcacagaagctc
tgcatgctggcctggagtgcacatccactagtgggacacatgcatctaagagaagaggga
gatgaagagactacaaatgatgttccccatatccagtgtggagatggctgtgatccccaa
ggactcagggacaacagtcagttctgcttgcaaaggatccaccagggtctgattttttat
gagaagctgctaggatcggatattttcacaggggagccttctctgctccctgatagccct
gtgggccagcttcatgcctccctactgggcctcagccaactcctgcagcctgagggtcac
cattgggagactcagcagattccaagccccggtcccagccagccatggcagcgcctcctt
ctccgcttcaaaatccttcgcagcctccaggcctttgtggctgtagctgcccgggtcttt
gcccatggagcggcaaccctgagtccctaa

DBGET integrated database retrieval system