KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100414263Help
Entry
100414263         CDS       T03264                                 

Definition
(RefSeq) galectin-16-like
  KO
K13334  eosinophil lysophospholipase (galectin-10) [EC:3.1.1.5]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:cjc04091]
    100414263
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100414263
Lectins [BR:cjc04091]
 S-type lectins (Galectins)
  100414263
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gal-bind_lectin
Motif
Other DBs
NCBI-GeneID: 100414263
NCBI-ProteinID: XP_002762165
Position
22
AA seq 210 aa AA seqDB search
MHVAFCACEGSSPHSSTFDEAAVCPFMCVNVDSRWLNWWGSWGFYVPDHRLHVCKSWGCA
LSDVSMARDDSSIPWQVPYKRPVSLSIGACVIIKGRPNLSFLNDPQLQVDFYTGTDEDSD
IAFHFRVHFGHRVVMNSREFGVWKLEEKLHYVPFEDGEPFDLRIYVFHNQYEVKVNGQYI
YGFAHRYPPSYVKMIQVWRDVSLTSVYVYN
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgcacgtggccttctgtgcatgtgaaggttcttccccacacagcagcacctttgatgaa
gcagctgtgtgtcctttcatgtgtgtcaatgtggattccaggtggcttaactggtgggga
tcttggggattttatgtccctgaccacaggcttcatgtgtgcaagtcctggggctgtgct
ctcagcgatgtgtccatggcccgtgatgattcctcaataccctggcaggtgccatacaaa
cgtcctgtgtccttgtctattggtgcctgtgtgattatcaaagggagaccgaacctctct
tttctcaatgacccacagctgcaggtggatttctacactgggacagatgaggactcagat
atcgccttccatttccgagtgcactttggccatcgtgtcgtcatgaacagtcgtgagttc
ggggtatggaagttggaagagaaattacactatgtgccctttgaggatggcgaaccattt
gacctgcgcatatacgtgtttcacaatcagtacgaggtaaaggtaaatggccaatacatt
tatggctttgcccatcgatacccgccatcatatgtgaagatgattcaagtgtggagagat
gtctccctgacctcagtgtatgtctacaattga

DBGET integrated database retrieval system