KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100414303
Entry
100414303         CDS       T03264                                 
Symbol
CADPS2
Name
(RefSeq) calcium dependent secretion activator 2
  KO
K19933  calcium-dependent secretion activator
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100414303 (CADPS2)
Membrane trafficking [BR:cjc04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    100414303 (CADPS2)
SSDB
Motif
Pfam: MUN PH
Other DBs
NCBI-GeneID: 100414303
NCBI-ProteinID: XP_002752111
Ensembl: ENSCJAG00000017339
Position
8:123387614..124004685
AA seq 1304 aa
MLDPSSSEEESDEGLEEESRDVLVAAGGSQRAPPAPAREGRRDAPGRAGGGGGGGAARSV
SPSPSVLSEGRDEPDRLLDDVHERRILSASYMLLIRCLAAPFLSSCPQFDIGRKKQKLNK
QQLQLLKERFQAFLNGETQIVADEAFCNAVRSYYEVFLKSDRVARMVQSGGCSANDFREV
FKKNIEKRVRSLPEIDGLSKETVLSSWIAKYDAIYRGEEDLCKQPNRMALSAVSELILSK
EQLYEMFQQILGIKKLEHQLLYNACQLDNADEQAAQIRRELDGRLQLADKMAKERKFPQF
IAKDMENMYIEELRSSVNLLMANLESLPVSKGGPEFKLQKLKRSQNSAFLDIGDENEIQL
SKSDVVLSFTLEIVIMEVEGLRSVAPNRIVYCTMEVEGEKLQTDQAEASRPQWGTQGDFT
TTHPRPVVKVKLFTESTGVLALEDKELGRVILYPTSNSSKSAELHRMVVPKNSQDSDLKI
KLAVRMDKPAHMKHSGYLYALGQKVWKRWKKRYFVLVQVSQYTFAMCSYREKKSEPQELM
QLEGYTVDYTDPHPGLQGGRMFFNAVKEGDTVIFASDDEQDRILWVQAMYRATGQSYKPV
PAIQTQKLNPKGGTLHADAQLSGKDGDRFQKHGMDEFISANPCKLDHAFLFRILQRQTLD
HRLNDSYSCLGWFSPGQVFVLDEYCARYGVRGCHRHLCYLTELMEHSENGAVIDPTLLHY
SFAFCASHVHGNRPDGIGTVSVEEKERFEEIKERLSSLLENQISHFRYCFPFGRPEGALK
ATLSLLERVLMKDIATPIPAEEVKKVVRKCLEKAALINYTRLTEYAKIEGPAEKETETMN
QASPARKLEEILHLAELCIEVLQQNEEHHAEAFAWWPDLLAEHAEKFWALFTVDMDTALE
AQPQDSWDSFPLFQLLNNFLRNDTLLCNGKFHKHLQEIFVPLVVRYVDLMESSIAQSIHR
GFEQETWQPVKNIANSLPNVALPKVPSLPLNLPQIPNISTPSWMPSLYESTNGSATSEDL
FWKLDALQMFVFDLHWPEQEFAHHLEQRLKLMASDMLEACVKRTRTAFELKLQKASKTTD
LRIPASMCTMFNVLVDAKKQSTKLCALDGGQEQQYHSKIDDLIDNSVKEIISLLVSKFVS
VLEGVLSKLSRYDEGTFFSSILSFTVKAAAKYVDVPKPGMDLADTYIMFVRQNQDILREK
VNEEMYIEKLFDQWYSNSIKVICLWLTDRLDLQLHIYQLKTLIKIVKKTYRDFRLQGVLE
GTLNSKTYDTVHRRLTVEEATASVSEGGGLQGITMKDSDEEEEG
NT seq 3915 nt   +upstreamnt  +downstreamnt
atgctggacccgtcttccagcgaggaggagtcggacgaagggctggaagaggagagccgc
gatgtgctggtggcagccgggggctcgcagagagctccgccggccccggctcgggaaggg
cggcgggacgcgcccgggcgcgcgggcggcggcggcggcggcggcgcggccagatccgtg
agcccgagcccctcggtgctcagcgaagggcgagacgagccggatcggctgctggacgat
gttcatgagcgcaggatcttatctgcttcttacatgctcctgattagatgcttggctgct
cccttcctttcttcatgtccacaattcgatataggaagaaaaaagcaaaaacttaacaag
caacagttgcagttactgaaagaacggttccaggccttcctcaatggggaaacccaaatt
gtagctgatgaagcattttgcaacgcagttcgcagttattatgaggtttttctaaagagt
gaccgagtggccagaatggttcagagtggagggtgttctgctaatgacttcagagaagtg
tttaagaaaaacatagaaaaacgtgtgcggagtttgccagaaatagacggcttgagcaaa
gagacggtcttgagctcatggatagccaaatatgatgccatttacaggggcgaagaggac
ttgtgcaaacagccaaataggatggccctgagtgcagtgtctgaacttattctgagcaag
gaacaactctatgaaatgtttcagcagattctgggtattaaaaaactagaacatcagctc
ctttataatgcatgtcagctggataatgcagatgaacaagcagcccagatcagaagggaa
cttgatggccggctgcaattggcagataaaatggcgaaggaaagaaaattcccccaattt
atagcaaaagatatggagaatatgtatatagaagagttgcggtcttcagtgaatttgcta
atggccaatttggaaagtcttccagtttctaaaggaggtccagaatttaaattacaaaaa
ttaaaacgttcacagaattctgcatttttggacataggggatgagaatgagattcagctg
tcaaagtctgacgtggtgctgtcattcaccttagagattgtcataatggaagtggaaggc
ttgaggtcagttgctcccaatcgaattgtttactgtacaatggaagtggaaggagaaaaa
ctgcagacagaccaggccgaagcctcaaggccacaatgggggactcaaggagattttacc
accacccatcctcggcctgtggtcaaagtgaaactcttcacagaaagcactggagttctg
gccctagaagataaagaactgggaagggtgatattatacccaacttctaatagctccaaa
tcagctgaattacaccgaatggtagttccaaaaaatagccaggactctgacttaaagatc
aaactggcagtgcgaatggataaaccagcgcatatgaagcatagtgggtatctgtatgcc
cttggacagaaggtttggaaaagatggaaaaaacgttactttgttctagttcaggttagc
cagtatacctttgctatgtgcagttatagagaaaaaaagtctgaaccacaagaattaatg
cagcttgaaggctatactgtggattatactgatccccacccaggtcttcagggtggtcgt
atgttctttaatgctgttaaagaaggagatactgtaatatttgccagtgatgatgaacag
gacagaatattatgggttcaagccatgtatagggccacaggtcaatcatataaaccagtt
cctgcgattcagacccagaaactgaatcctaaaggaggaactctccatgcagatgctcag
ctttctggtaaagatggagatcgttttcagaaacatgggatggatgagtttatttctgca
aacccctgcaagctcgatcacgccttcctttttagaatactccagaggcagactttggat
cacagactgaatgattcctattcttgcttgggttggtttagccccggccaagtctttgtg
ttagatgagtactgtgcccgttatggtgtaagaggctgtcacagacatctctgctacctt
acagaactgatggaacattcagaaaatggtgctgtcattgaccctaccctgctccattac
agctttgcattctgtgcctctcatgtgcacggcaacaggcctgatggaattgggactgtt
tcagtggaagaaaaagaaagatttgaggagataaaagagagactttcttctcttttagaa
aatcagataagccatttcagatactgctttccctttggacgacctgaaggtgctctaaaa
gctacactttcattacttgaaagggttttaatgaaagatattgccactcccataccagca
gaagaggtgaagaaagtggtcagaaaatgtctcgagaaagctgccttgatcaattacact
agactcacagaatatgccaaaatagaaggcccagcagaaaaggaaacagagaccatgaac
caggcatctcctgctagaaagctggaagagattcttcatctagcagagctctgcatagaa
gtcttgcagcagaatgaagagcatcatgcagaggcattcgcctggtggcctgatttgttg
gctgaacatgcagagaaattttgggctttatttacagtggatatggacactgcactagag
gctcaaccacaagactcctgggatagttttcctcttttccaactgcttaataatttcctc
cgaaatgacacacttttgtgtaatgggaaatttcacaaacacttgcaagaaatctttgta
cccttggttgtccgctacgtggatctcatggagtcctccatcgcccagtcaattcacaga
ggttttgagcaggaaacgtggcagcctgtcaagaatatcgccaacagtcttcccaatgta
gctcttccaaaagttccaagtctgcctcttaatcttccacagattcctaacatttctact
ccttcgtggatgccttctttatatgagtccaccaatggctcagcaacatcagaagacctt
ttttggaaacttgatgcactgcagatgtttgtctttgatctacactggccggaacaggaa
tttgcccaccacttagagcaaagacttaaactaatggccagtgacatgctagaggcctgt
gtcaaaagaacaagaactgcatttgaactcaagctgcaaaaggcaagcaaaacaactgac
ttgcgcattccagcttccatgtgcacaatgtttaatgtattagtcgatgccaaaaagcaa
agcaccaaactctgtgctctggatggaggacaagagcaacaataccattcaaaaatagat
gatctgatcgacaacagcgtaaaagaaatcatttcactgttagtttccaagtttgtttca
gtgttggaaggcgtgttgtctaagctgtcaaggtatgatgaaggcactttcttttcatcc
attctgtcattcactgtgaaagcagccgcaaaatatgttgatgttccaaaaccaggaatg
gatctggcagacacctatattatgtttgttcgacaaaaccaagatattcttcgagaaaag
gtcaatgaggaaatgtatatagaaaagttatttgatcaatggtacagcaattccataaaa
gtcatttgcctgtggttgactgatagactagacctccagctccatatttaccagctgaag
acgctcatcaagattgtgaagaaaacctacagggacttccgattgcagggtgtgttggaa
ggaacactgaacagtaagacttatgatactgtgcacagacgtttaacagtagaggaggcc
acagcctctgtttcagaaggagggggacttcagggcattactatgaaagacagtgatgaa
gaagaagaaggctga

DBGET integrated database retrieval system