KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100414336Help
Entry
100414336         CDS       T03264                                 

Gene name
THNSL2
Definition
(RefSeq) threonine synthase like 2
  KO
K06037  O-phospho-L-threonine phospho-lyase [EC:4.2.3.-]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    100414336 (THNSL2)
Enzymes [BR:cjc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.-  
     100414336 (THNSL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-GeneID: 100414336
NCBI-ProteinID: XP_008978609
Ensembl: ENSCJAG00000019349
UniProt: U3AZV5
Position
14
AA seq 485 aa AA seqDB search
MWYVSTRGMAPRVDFEGALFSGYASDGGLFMPEELPQLNRETLCQWSTLSYPGLVKELCA
LFIGSELIPKDDLNDLIDRAFSRFRHRDVVHLSRLRNGLNVLELWHGVTYAFKDLSLSCT
AQFLQYFLEKKEKHVTVVIGTSGDTGSAAIESVQGAKNVDIIVLLPKGHCTKIQELQMTT
VLKENVHVFGVEGNSDELDEPIKAVFADTVFVKKHNLMSLNSINWSRILVQMAHHFFAYF
QCAPSLDTHPLPLVEVVVPTGAAGNLAAGYIAQKIGLPIRLVVAVNRNDIIHRTVQQGDF
SLSEVVKSTLASAMDIQVPYNMERVFWLLSGSDSQVTRALMEQFERTQSLNLPKELHSKL
SEAMTSESVSDEAIIQTMGRCWDENQYLLCPHSAVAVNYHYQQMDRQQPSSTPRCCLAPA
SAAKFPEAVLAAGLTPETPAEIRALEHKETRCTPMRRGDTWMLMLRDTIEDLSRRWKGHV
LNASQ
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtggtacgttagcaccaggggcatggccccacgggtcgactttgagggggccctcttc
tctggctatgcatccgacggaggcctctttatgcctgaggagctcccacagttgaacaga
gagaccctgtgtcagtggagcacactctcctatcctggcctcgtgaaggagctgtgtgcc
ctcttcattggctctgagctcattccaaaagatgacttaaatgatctgattgaccgagcc
ttcagcagattccgtcacagagacgtggtccatctctccaggttgaggaatgggctgaac
gtgttggagctgtggcatggcgtcacgtatgcatttaaggacctgtccctgtcctgcaca
gcacagttcctacagtacttcctggagaagaaggagaagcacgtcactgtggtcatagga
acatctggggacacaggaagtgctgccattgagagtgttcaaggggcaaagaatgtggac
attattgttttgctgcccaaaggtcactgcacaaagattcaggagctccagatgacaacg
gtgctgaaggagaatgtccatgtgtttggagtggagggaaacagtgatgagcttgatgag
ccgataaaggccgtgtttgctgatacggtttttgtcaagaagcacaatctgatgagcctg
aattcgatcaactggtcccggatcctggtgcagatggcccaccacttctttgcttacttc
cagtgtgcaccgtccttggacacgcatcccctacccctggtggaggtggttgtgccaaca
ggggctgctggtaaccttgcagctgggtacattgctcagaagataggcctgcccatccgt
ctggttgtggcagtgaaccgcaatgacatcatccacaggactgtccagcagggagacttc
tctctgtctgaggttgttaaatcaaccttggcatcagctatggacattcaggtgccctac
aacatggaaagggtattctggctgctctctggctctgacagccaggtgacaagagccctc
atggagcagtttgaaaggacccaaagtctgaatctgcccaaggaactgcacagcaagctt
tcagaggcgatgacatccgagtcagtgtcggatgaagccatcatccagaccatgggccgc
tgttgggacgagaaccagtacttgctgtgcccccactcggcggtggccgtgaactaccat
taccagcagatggacaggcagcagcccagcagcactccccggtgctgcctggcccctgcc
tctgcagccaagttcccggaagctgtcctggctgctggcctgacccctgagactcctgca
gagatcagagccctggagcacaaggagacacgctgcaccccgatgcggagaggtgacacc
tggatgctgatgcttcgggacaccattgaggaccttagccggcggtggaagggacatgtt
ctgaacgcctcccagtag

DBGET integrated database retrieval system