KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100414469Help
Entry
100414469         CDS       T03264                                 

Gene name
LYPLA1
Definition
(RefSeq) lysophospholipase I
  KO
K06128  lysophospholipase I [EC:3.1.1.5]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00564  Glycerophospholipid metabolism
cjc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100414469 (LYPLA1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100414469 (LYPLA1)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100414469 (LYPLA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_2 Hydrolase_4 Abhydrolase_3 Abhydrolase_6 Abhydrolase_1 Cutinase DUF2974 FSH1 DLH Esterase Lipase_3 Thioesterase AXE1 Palm_thioest
Motif
Other DBs
NCBI-GeneID: 100414469
NCBI-ProteinID: XP_002758950
Ensembl: ENSCJAG00000011562
UniProt: F6R2S9
Position
16
AA seq 230 aa AA seqDB search
MCGNNMSAQLPAVVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVMP
VTLNMNMAMPSWFDIIGLSPDSQEDEPGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQ
GGALSLYTALTMQQKLAGVTALSCWLPLRASFPQGPISGANRDISILQCHGDCDPLVPLM
FGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKVLPPID
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcaataacatgtcagcccagctgcccgccgttgtccccgctgcccggaaggcc
accgccgcggtgattttccttcatggattgggagatactgggcacggatgggcagaagcc
tttgcaggtatcagaagttcacatatcaaatatatctgcccgcatgcgcctgttatgcct
gttacactaaatatgaacatggctatgccttcatggtttgatattattgggctttcacca
gattcacaggaggatgaacctgggattaaacaggctgcagaaaacataaaagctttgatt
gatcaagaagtgaagaatggcattccttcaaacagaattattttgggaggattttctcag
ggaggagctttatctttatatactgcccttaccatgcagcagaaactggcgggtgtcact
gcactcagttgctggcttccacttcgggcatcatttccacaggggcctatcagtggtgcc
aatagagatatttctattcttcagtgccacggagattgtgaccctttagttcccctgatg
tttggttctcttacggttgaaaaactaaaaacattggtgaatccagccaatgtgaccttt
aaaacctatgaaggtatgatgcacagttcatgtcaacaggaaatgatggatgtcaagcaa
ttcattgataaagtcctacctccaattgattga

DBGET integrated database retrieval system