KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100414522
Entry
100414522         CDS       T03264                                 
Symbol
PDE1A
Name
(RefSeq) phosphodiesterase 1A
  KO
K13755  calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase [EC:3.1.4.17]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00230  Purine metabolism
cjc01100  Metabolic pathways
cjc04020  Calcium signaling pathway
cjc04740  Olfactory transduction
cjc04742  Taste transduction
cjc04924  Renin secretion
cjc05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100414522 (PDE1A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100414522 (PDE1A)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    100414522 (PDE1A)
  09157 Sensory system
   04740 Olfactory transduction
    100414522 (PDE1A)
   04742 Taste transduction
    100414522 (PDE1A)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100414522 (PDE1A)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     100414522 (PDE1A)
SSDB
Motif
Pfam: PDEase_I PDEase_I_N
Other DBs
NCBI-GeneID: 100414522
NCBI-ProteinID: XP_008996841
Ensembl: ENSCJAG00000011397
Position
6:36015942..36394911
AA seq 545 aa
MGSRVTEIEELENTTFKYLIGEQTEKMWQRLKGILRCLVKQLERGDVNVIDLKKNIEYAA
SVLEAVYIDETRRLLDTEDELSDIQTDSVPYEVRYWLASTFTRKMGVTKKKPEEKPKFRS
IVHAVQAGIFVERMYRKTYHMVGLAYPAAVMVTLKDVDKWSFDVFALNEASGEHSLKFMI
YELFTRYDLINHFKIPVSRLIAFAEALEVGYSKYKNPYHNLIHAADVTQTVHYIMLHTGI
MHWLTELEILAMIFAAAIHDYEHTGTTNNFHIQTRSDVATLHNDRSVLENHHVSAAYRLM
QEEEMNILINLSNDDWRDLRNLVIEMVLSTDMSGHFQLIKNIRNSLQQPEGIDRAKIMSL
ILHAADISHPAKSWKLHYRWTMAIMEEFFLQGDKEAELGLPFSPLCDRKSTMVAQSQIGF
IDFIVEPTFSLLTDLTEKIVIPLIEEASKAGTSSYVESSSTTIVGLHIADALRRSNTKGS
MSDRSYSPDYSLAAVDLKSFKNNLVDIIQQNKQRWKELAAQGESDLHTNSEDLVNAEEKH
AETHS
NT seq 1638 nt   +upstreamnt  +downstreamnt
atggggtctcgtgttacagaaattgaagaactggaaaacaccacttttaagtatctcata
ggagaacagactgaaaaaatgtggcagcgcctgaaaggaatactaagatgcttagtgaag
cagctggaaagaggtgacgttaacgtgattgacttgaagaagaatattgaatatgcagca
tctgtgctggaagcagtttatatcgatgaaacaagaagacttctggatactgaagatgag
ctcagtgacattcagactgactcagtaccatatgaagttcggtactggttggcatctacc
tttacacggaaaatgggggtgacaaaaaagaaacctgaggaaaaacccaaatttcggagc
attgtgcatgctgttcaagctggaatttttgtggaaaggatgtaccgaaaaacatatcat
atggttggtttggcatatccagcagctgtcatggtaacattaaaggatgttgataaatgg
tcttttgatgtatttgccctaaatgaagcaagtggagagcatagtctgaagtttatgatt
tatgaactgtttaccagatatgatcttatcaaccatttcaagattcctgtgtctcgccta
attgcctttgcagaagctttagaagttggttacagcaagtacaaaaatccatatcacaat
ttgattcatgcagctgatgtcactcaaactgtgcattacataatgcttcatacaggtatc
atgcactggctcaccgaactggaaattttagcaatgatctttgctgctgccattcatgat
tatgagcatacaggaaccacaaacaactttcatattcagacaaggtcagatgttgccact
ttgcataatgatcgctctgtccttgagaatcaccacgtgagtgcagcttatcgacttatg
caagaagaggaaatgaatatcttgataaatttatccaacgatgactggagggatcttcgg
aacctagtgattgaaatggttttatctacagacatgtcaggtcacttccagctaattaaa
aatataagaaacagtttgcagcagcctgaagggattgacagagccaaaatcatgtccctg
attctccatgcagcagacatcagccacccagccaaatcctggaagctgcactatcggtgg
accatggccataatggaggagtttttcctgcagggagataaagaagctgagttagggctt
ccattttccccactttgtgatcggaagtcaactatggtggcccagtcacaaataggtttc
attgatttcatagtagagccaacattttctcttctgacagacttaacagagaaaattgtt
attcctcttatagaggaagcctcaaaagccggaacttcttcctatgtggaaagcagctca
accaccattgtggggttacacattgctgacgcactaagacgatcaaatacaaaaggctcc
atgagcgataggtcctattccccagactactcccttgcggccgtggacctgaagagcttc
aagaacaacctggtggacatcattcagcagaacaaacagaggtggaaagagttagctgca
caaggtgaatctgatcttcatacgaactcagaagacttagtaaatgctgaagaaaaacat
gcggagacacattcatag

DBGET integrated database retrieval system