KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100414587Help
Entry
100414587         CDS       T03264                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00561  Glycerolipid metabolism
cjc01100  Metabolic pathways
cjc04714  Thermogenesis
cjc04723  Retrograde endocannabinoid signaling
cjc04923  Regulation of lipolysis in adipocytes
Module
cjc_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    100414587 (MGLL)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100414587 (MGLL)
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    100414587 (MGLL)
  09159 Environmental adaptation
   04714 Thermogenesis
    100414587 (MGLL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cjc01002]
    100414587 (MGLL)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100414587 (MGLL)
Peptidases [BR:cjc01002]
 Serine Peptidases
  Family S33
   100414587 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Lipase_3 Esterase DLH Abhydrolase_5 BAAT_C PGAP1 Thioesterase
Motif
Other DBs
NCBI-GeneID: 100414587
NCBI-ProteinID: XP_017820632
Position
15
AA seq 303 aa AA seqDB search
MPEESSPRRTPQSVPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAAEHCGRYDE
LAQMLKGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSVQKDYPGLPVFLLG
HSMGGAIVILTAAERPGFFAGKKLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPID
SSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADR
LCDSKGAYLLMESAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTSVTGTS
SPP
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgccagaggaaagttcccccaggcggaccccgcagagcgttccctaccaggacctccct
cacctggtcaatgcagacggacagtacctcttctgcaggtactggaaacccacaggcaca
cccaaggcccttatctttgtttcccatggagctgcggagcactgtggccgctacgatgag
ctagctcagatgctgaaggggctggacctgctggtgtttgcccatgaccacgttggtcac
ggacagagcgaaggggaaaggatggtagtgtctgacttccatgtttttgtcagagatgtg
ttgcagcatgtggattccgtgcagaaagactaccctgggcttcctgtcttccttctggga
cattccatgggaggtgccatcgtcatcctcacggccgcagagagaccgggcttcttcgcc
ggcaaaaaactcatttcgcctctggttcttgccaatcctgaatctgcaacaacttttaag
gtccttgctgcaaaagtgctcaaccttgtgctgccaaacttgtcactcgggcccattgac
tccagcgtgctctctcggaataagacagaggtggacatttataactcagatcctctgatc
tgccgggcagggctgaaggtatgcttcggcatacagctgctgaatgccgtctctcgggtg
gagcgcgccctccccaagctgactgtgcccttcctgctgctccagggctctgccgaccgc
ctgtgtgacagcaaaggggcctacctgctcatggaatcagccaagagccaggacaagact
ctcaagatttatgaaggtgcctaccatgttctccacaaagagcttcctgaagtcaccaac
tctgtcttccatgaaataaacatgtgggtctctcaaaggacgtccgtgacaggaacttcg
tccccaccctga

DBGET integrated database retrieval system