KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100414848Help
Entry
100414848         CDS       T03264                                 

Gene name
EDN1
Definition
(RefSeq) endothelin 1
  KO
K16366  endothelin-1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04024  cAMP signaling pathway
cjc04066  HIF-1 signaling pathway
cjc04080  Neuroactive ligand-receptor interaction
cjc04270  Vascular smooth muscle contraction
cjc04668  TNF signaling pathway
cjc04916  Melanogenesis
cjc04924  Renin secretion
cjc04926  Relaxin signaling pathway
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc05200  Pathways in cancer
cjc05410  Hypertrophic cardiomyopathy (HCM)
cjc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100414848 (EDN1)
   04066 HIF-1 signaling pathway
    100414848 (EDN1)
   04024 cAMP signaling pathway
    100414848 (EDN1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100414848 (EDN1)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100414848 (EDN1)
   04916 Melanogenesis
    100414848 (EDN1)
   04924 Renin secretion
    100414848 (EDN1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100414848 (EDN1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100414848 (EDN1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100414848 (EDN1)
   05410 Hypertrophic cardiomyopathy (HCM)
    100414848 (EDN1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100414848 (EDN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Endothelin
Motif
Other DBs
NCBI-GeneID: 100414848
NCBI-ProteinID: XP_017826397
Ensembl: ENSCJAG00000005130
UniProt: F7H803
Position
4
AA seq 213 aa AA seqDB search
MDYLPMIFFLLLAAFQGAPETAVLGAELSTVGENSGGKPTPSPPLRLRRSKRCSCSSLMD
KECVYFCHLDIIWVNTPEHVAPYGLGSPRAKRALENLLLPLAAAAPKNRCQCASQKDNKC
WNFCQAGRELGALDSMEIARDTHKKGKHCIKLGKRFARQQLVRGRRIRRNSDERLRQNRS
ETISNKVKQSSRDSKLKTKPSREYSVTHNRAHW
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggattatttgcccatgattttctttctgctgttggcggctttccaaggagctccagaa
acagcggtcttgggcgctgagctcagcacagtgggtgagaacagcgggggaaaacccact
cccagtccacccttgaggctccgccggtccaagcgctgctcctgctcgtccctgatggat
aaagagtgtgtctacttttgccacctggacatcatctgggtcaacactcccgagcacgtt
gctccatatggacttggaagccctagggccaagcgagccttggagaatttacttctccca
ctggcagcagcagcccccaagaatagatgccaatgtgcaagccaaaaagacaataagtgc
tggaatttttgccaggcaggaagagaactcggggccctagacagtatggagattgcccgg
gatacccataagaaaggaaaacactgtatcaagcttgggaaaaggtttgctcgtcagcag
ttagtgagaggaagaagaatcagaagaaattcagatgaacgcctaagacaaaacaggtca
gagaccatcagcaacaaggtcaaacaatcttctcgtgattccaagctgaaaaccaagccc
tccagggagtacagtgtaacccacaaccgagcacattggtga

DBGET integrated database retrieval system