KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100414905Help
Entry
100414905         CDS       T03264                                 

Gene name
PTPN11
Definition
(RefSeq) protein tyrosine phosphatase, non-receptor type 11
  KO
K07293  tyrosine-protein phosphatase non-receptor type 11 [EC:3.1.3.48]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04014  Ras signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04360  Axon guidance
cjc04625  C-type lectin receptor signaling pathway
cjc04630  Jak-STAT signaling pathway
cjc04650  Natural killer cell mediated cytotoxicity
cjc04670  Leukocyte transendothelial migration
cjc04722  Neurotrophin signaling pathway
cjc04920  Adipocytokine signaling pathway
cjc04931  Insulin resistance
cjc05168  Herpes simplex virus 1 infection
cjc05205  Proteoglycans in cancer
cjc05211  Renal cell carcinoma
cjc05220  Chronic myeloid leukemia
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100414905 (PTPN11)
   04630 Jak-STAT signaling pathway
    100414905 (PTPN11)
   04072 Phospholipase D signaling pathway
    100414905 (PTPN11)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100414905 (PTPN11)
   04650 Natural killer cell mediated cytotoxicity
    100414905 (PTPN11)
   04670 Leukocyte transendothelial migration
    100414905 (PTPN11)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100414905 (PTPN11)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100414905 (PTPN11)
  09158 Development
   04360 Axon guidance
    100414905 (PTPN11)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100414905 (PTPN11)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100414905 (PTPN11)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100414905 (PTPN11)
   05211 Renal cell carcinoma
    100414905 (PTPN11)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100414905 (PTPN11)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100414905 (PTPN11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cjc01009]
    100414905 (PTPN11)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100414905 (PTPN11)
Protein phosphatases and associated proteins [BR:cjc01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    100414905 (PTPN11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Y_phosphatase SH2 DSPc Y_phosphatase3 PTPlike_phytase
Motif
Other DBs
NCBI-GeneID: 100414905
NCBI-ProteinID: XP_002753071
Ensembl: ENSCJAG00000012464
UniProt: F7ICW6
Position
9
AA seq 593 aa AA seqDB search
MTSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTG
DYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLNCADPTSERWFHGHLSGK
EAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDKGESNDGKSKVTHVMIRCQELKYD
VGGGERFDSLTDLVEHYKKNPMVETLGTVLQLKQPLNTTRINAAEIESRVRELSKLAETT
DKVKQGFWEEFETLQQQECKLLYSRKEGQRQENKNKNRYKNILPFDHTRVVLHDGDPNEP
VSDYINANIIMPEFETKCNNSKPKKSYIATQGCLQNTVNDFWRMVFQENSRVIVMTTKEV
ERGKSKCVKYWPDEYALKEYGVMRVRNVKESAAHDYTLRELKLSKVGQGNTERTVWQYHF
RTWPDHGVPSDPGGVLDFLEEVHHKQESIMDAGPVVVHCSAGIGRTGTFIVIDILIDIIR
EKGVDCDIDVPKTIQMVRSQRSGMVQTEAQYRFIYMAVQHYIETLQRRIEEEQKSKRKGH
EYTNIKYSLADQTSGDQSPLPPCTPTPPCAEMREDNARVYENVGLMQQQKSFR
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgacatcgcggagatggtttcatccaaatatcactggtgtggaggcagaaaacctacta
ttgacaagaggagttgatggcagttttttggcaaggcctagtaaaagtaaccctggagac
ttcacactttccgttagaagaaatggagctgtcacccacatcaagattcagaacactggt
gattactatgacctgtatgggggggagaagtttgccactttggctgagttggtccagtat
tacatggaacatcatgggcaattaaaagagaagaatggagatgttattgagcttaaatat
cctctgaactgtgcagatcctacctctgaaaggtggtttcatggacacctctctgggaaa
gaagcagagaaattattaactgaaaaaggaaagcatggtagctttcttgtacgagagagc
cagagccaccctggagattttgttctctctgtgcgcactggtgatgacaaaggggagagc
aatgatggcaagtctaaagtgacccacgtcatgattcgctgtcaggaactgaaatacgat
gttggtggaggagaacggtttgattctttgacagatcttgtggaacattacaagaagaat
cctatggtggaaacattgggtacagtactacaactcaagcagccccttaacacgactcgt
ataaacgctgctgaaatagaaagcagagttcgagaactaagcaaattagctgagaccaca
gataaagtcaagcaaggcttttgggaagaatttgagacactacaacaacaggagtgcaaa
cttctctatagccgaaaagagggtcaaaggcaagaaaacaaaaacaaaaatagatataaa
aacatcctgccctttgatcataccagggttgtcctacatgacggggatcccaatgagcct
gtttcagattacatcaatgcaaatatcatcatgcctgaatttgaaaccaagtgcaacaat
tcaaagcccaaaaagagttacattgccacacaaggctgtctgcaaaacacggtgaacgac
ttttggcggatggtcttccaagaaaactcccgagtgattgttatgacaacaaaagaagtg
gagagaggaaagagtaagtgtgtcaaatactggcctgatgagtatgctctcaaagaatat
ggggtcatgcgtgttaggaacgtcaaagaaagtgctgctcatgactatacgctacgagaa
ctaaaactttcaaaggttggacaagggaatacggagagaacggtctggcaataccacttt
cggacctggccggaccacggagtgcccagcgaccctgggggtgtgctggacttcctggag
gaggtgcaccataagcaggagagcatcatggatgcagggccagtcgtggtgcactgcagt
gctggaattggccggacagggacgttcattgtgattgatattcttattgacatcatcaga
gagaaaggtgttgactgcgacattgatgttcccaaaaccatccagatggtgcgatctcag
aggtcagggatggtccagacagaagcacagtaccgatttatctatatggcggtccagcat
tatattgaaacactacagcgcaggattgaagaagagcagaaaagcaagaggaaagggcac
gaatatacaaatattaagtattctctagcggaccagacgagtggagatcagagcccgctc
ccgccttgtactccaacgccaccctgtgcagaaatgagagaagacaatgctagagtctat
gaaaatgtgggcctgatgcaacagcagaaaagtttcagatga

DBGET integrated database retrieval system