KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100414977Help
Entry
100414977         CDS       T03264                                 

Gene name
JAG1
Definition
(RefSeq) jagged 1
  KO
K06052  jagged-1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01522  Endocrine resistance
cjc04330  Notch signaling pathway
cjc04371  Apelin signaling pathway
cjc04658  Th1 and Th2 cell differentiation
cjc04668  TNF signaling pathway
cjc05165  Human papillomavirus infection
cjc05200  Pathways in cancer
cjc05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    100414977 (JAG1)
   04371 Apelin signaling pathway
    100414977 (JAG1)
   04668 TNF signaling pathway
    100414977 (JAG1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100414977 (JAG1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100414977 (JAG1)
  09162 Cancer: specific types
   05224 Breast cancer
    100414977 (JAG1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100414977 (JAG1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100414977 (JAG1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:cjc04090]
    100414977 (JAG1)
CD molecules [BR:cjc04090]
 Proteins
  100414977 (JAG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF hEGF MNNL EGF_2 DSL EGF_CA cEGF EGF_3 MAP17
Motif
Other DBs
NCBI-GeneID: 100414977
NCBI-ProteinID: XP_017827145
Ensembl: ENSCJAG00000021357
Position
5
AA seq 1233 aa AA seqDB search
MRSPRARGRPGRPLSLLLALLCTLRAKVCGAAGQFEWELLSMQNVNGELQNGNCCGGARN
PGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGQGSTPVIGGNTFTFKASRGNDRNRI
VLPFSFAWPRSYTLLVEAWDSSNNTLRKYHLYGLFSKYMWKCRAWPTSWSWICLLTQKLD
AFEPWLLCLTDPFYEDLNPCDCDDYYYGFGCNKXCRPRDDFFGHYTCDQNGNKTCMEGWM
GSECNRAICRQGCSTKHGSCKHPGDCRCQYGWQGLYCDKCIPHPGCVHGICIEPWQCLCE
TNWGGQLCDKDLNYCGTHQPCLNGGACSNTGPDKYQCSCPEGYSGVSCEIAEHACLSDPC
HNRGSCKETSLGFECECSPGWTGPTCSTNIDDCSPNNCSHGGTCQDLVNGFKCVCPPQWT
GKTCQLDANECEAKPCVNAKSCKNLIASYYCDCLPGWMGQNCDININDCLGQCQNDASCQ
DLVNGYRCICPPGYAGDHCERDIDECASNPCLNGGHCQNEINRFQCLCPTGFSGNLCQLD
IDYCEPNPCQSGAQCYNRASDYFCKCPEDYEGKNCSHLKDHCRTTPCEVIDSCTVAMASN
DTPEGVRYISSNVCGPHGKCKSQSGGKFTCDCNKGFTGTYCHENINDCESNPCKNGGTCI
DGVNSYKCICSDGWEGTYCETNINDCSQNPCHNGGTCRDLVNDFYCDCKNGWKGKTCHSR
DSQCDEATCNNGGTCYDEGDAFKCMCPGGWEGTTCNIARNSSCLPNPCHNGGTCVVNGES
FTCVCKEGWEGPICTQNTNDCSPHPCYNSGTCVDGDNWYRCECAPGFAGPDCRININECQ
SSPCAFGATCVDEINGYRCVCPPGHSGAMCQEVSGRPCITMGSVIPDGAKWDDDCNTCQC
LNGRIACSKVWCGPRPCLLHKGHSECPNGQNCIPILDDQCFVRPCTGVGECRSSGLQPVK
TKCTSDSYYQDNCANITFTFNKEMMSPGLTTEHICSELRNLNILKNVSAEYSIYIACEPS
PSANNEIHVAISAEDIRDDGNPVKEITDKIIDLVSKRDGNSSLIAAVAEVRVQRQPQKNR
TDFLVPLLSSVLTVAWICCLATALYWCLRKRRKPGSHTHSASEDNTTNNVREQLNQIKNP
IEKHGANTVPIKDYENKNSKMSKIRTHNSEVEEDDMDKHQQKARFAKQPAYTLVDREEKP
PNSTPTKHPNWTNKQDNRDLESAQSLNRMEYIV
NT seq 3702 nt NT seq  +upstreamnt  +downstreamnt
atgcggtccccacgggcgcgcggccggcccgggcgccccctaagcctcctgctcgccctg
ctctgtaccctgcgagccaaggtgtgcggggccgcgggtcagttcgagtgggagcttctg
tctatgcagaacgtgaacggggagctgcagaacgggaactgctgcggcggcgcccggaac
ccgggagaccgcaagtgtacccgcgacgagtgtgacacatacttcaaagtgtgcctcaag
gagtatcagtcccgcgtcacggctgggggaccctgcagcttcggacaagggtccacgcct
gtcatcgggggtaacaccttcaccttcaaggccagccgcggcaacgaccgcaaccgcatc
gtactgcctttcagtttcgcctggccgaggtcctatacattgcttgtggaggcgtgggat
tccagtaataacactcttcgtaagtatcacttgtatggacttttctctaaatacatgtgg
aagtgtagggcttggccaaccagctggagttggatctgtctccttactcagaagctggat
gccttcgagccatggctactgtgtttaaccgatcccttttatgaagatcttaatccgtgt
gactgcgatgattactactatggctttggctgcaataagntctgccgccccagagatgac
ttctttggacactatacctgtgatcagaatggcaacaaaacttgcatggaaggctggatg
ggctccgaatgtaacagagctatttgccgacaaggctgcagtaccaagcatgggtcttgc
aaacacccaggtgactgcaggtgccagtatggctggcaaggcctgtactgtgataagtgc
atcccgcacccaggatgtgtccacggcatctgtatcgagccctggcagtgcctctgtgag
accaactggggcggccagctctgtgacaaagatctcaattattgtggaacccatcagccg
tgtctcaacgggggagcttgtagcaacacgggccctgacaaatatcagtgttcctgccct
gagggatattcaggagtcagctgtgaaattgctgagcacgcctgcctctctgatccctgc
cacaacagaggcagctgtaaggagacctccctgggctttgagtgtgagtgttccccaggc
tggaccggccccacgtgctctacaaacattgatgactgttctcccaataactgttcccac
gggggcacctgccaggacctggttaatggatttaagtgtgtgtgccccccacagtggact
ggcaaaacgtgccagttagatgcaaatgaatgtgaggccaaaccttgtgtaaatgccaaa
tcctgtaagaatctgattgccagctactactgcgactgtcttcctggctggatgggtcag
aattgtgacataaatattaacgactgccttggccagtgccagaacgatgcctcctgtcag
gacttggttaatggttatcgctgtatctgtccacctggctatgcaggcgatcattgtgag
agagacatcgatgaatgtgccagcaacccctgtttgaatgggggtcactgtcagaatgaa
atcaacagattccagtgtctgtgtcccactggtttctctggaaacctctgtcagctggac
atcgattattgtgagcccaatccctgccagagcggtgctcagtgctacaaccgtgccagc
gactatttctgcaagtgccctgaggactatgagggcaagaactgctcacacctgaaagat
cactgccgcacgaccccctgcgaagtgattgacagctgcacagtggccatggcttccaac
gacacacctgaaggggtgcggtatatttcctcgaacgtctgtggtccccacgggaagtgc
aagagtcagtcgggaggcaaattcacctgtgattgtaacaaaggcttcacgggaacatac
tgccatgaaaatattaatgactgtgagagcaacccctgtaaaaatggtggcacttgcatc
gatggggtcaactcctacaagtgcatctgcagcgatggctgggaggggacctactgtgaa
accaatatcaatgactgcagccagaacccctgccacaatgggggcacatgtcgtgacctg
gtcaatgacttctactgtgactgtaaaaatgggtggaaaggaaagacatgccactctcgt
gacagtcagtgtgacgaggccacgtgcaacaatggtggcacctgctatgacgagggggat
gcttttaagtgcatgtgtcctggcggctgggaaggaaccacctgtaacatagcacgaaac
agtagctgccttcccaacccctgccacaatgggggcacatgtgtggtcaacggcgagtcc
tttacgtgcgtctgcaaggaaggctgggaggggcccatctgtactcagaataccaatgac
tgcagccctcatccctgttacaacagcggcacctgtgtggatggagacaactggtaccgg
tgcgaatgtgccccaggttttgctgggcccgactgcagaataaacatcaacgaatgccag
tcttcaccttgtgcctttggggcaacctgtgtggatgagatcaatggctaccggtgtgtc
tgtcctccagggcacagtggtgccatgtgccaggaagtttcaggaagaccttgcatcacc
atggggagtgtgataccagatggggccaaatgggatgatgactgtaacacctgccagtgt
ctgaatggacggattgcctgctcaaaggtctggtgtggccctcgaccctgcctgctccac
aaagggcacagcgagtgccctaatgggcagaactgcatccccatcctggacgaccagtgc
ttcgtccgcccctgcactggtgtgggcgagtgtcggtcttccggtctccagccggtgaag
acgaagtgcacctctgactcctattaccaggataattgtgcaaacatcacgttcaccttt
aacaaggagatgatgtcaccgggtcttaccactgagcacatttgcagcgaattgaggaat
ttgaatattttgaagaatgtttccgctgaatattcaatctatatcgcttgtgagccctct
ccttctgcgaacaatgaaatacacgtggccatttctgctgaagatatacgggatgatgga
aacccagtcaaggaaatcaccgacaaaatcatcgatcttgttagtaaacgtgatggaaac
agctcactgattgctgctgttgcagaagtaagagttcagaggcagcctcagaagaacaga
acagatttcctggtgccgttgctgagctctgtcttaaccgtggcttggatctgttgcttg
gcgacggccttgtactggtgcctgcggaagaggcggaagccaggcagccacacacactca
gcctctgaggacaacaccaccaacaacgtgcgggagcagctgaaccagatcaaaaacccc
attgagaaacatggggccaacacggtccccatcaaggattatgagaacaaaaactccaaa
atgtctaaaataaggacacacaactctgaagtcgaagaggatgacatggataaacaccag
cagaaagcccggtttgccaagcagccggcgtacacgctggtagacagagaagagaagccc
cccaatagcacaccgacaaaacatccaaactggacaaacaaacaggacaacagagacttg
gagagtgcccagagcttaaaccggatggagtacatcgtatag

DBGET integrated database retrieval system